Entry information : MtPrx66 (Medtr4g114210.1[4.0] / Medtr8g120300.1[3.0])
Entry ID 391
Creation 2009-01-02 (Christophe Dunand)
Last sequence changes 2011-11-25 (Qiang LI)
Sequence status complete
Reviewer Harold Duruflé
Last annotation changes 2016-06-17 (Harold Duruflé)
Peroxidase information: MtPrx66 (Medtr4g114210.1[4.0] / Medtr8g120300.1[3.0])
Name (synonym) MtPrx66 (Medtr4g114210.1[4.0] / Medtr8g120300.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Arbuscular mycorrhiza (inoculated root)
Root tips
Roots
Inducers Nitrogen starvation
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx66
start..stop
S start..stop
GmPrx320 573 0 1..320 1..320
LjPrx51 535 0 5..320 6..322
RcPrx09 533 0 8..320 9..321
PpePrx26 532 0 7..320 8..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47049980..47050177 198 N° 2 47049324..47049503 180 N° 3 47049037..47049199 163 N° 4 47048462..47048883 422
complement(join(47048462..47048883,47049037..47049199,47049324..47049503,4704998 0..47050177))


exon

Literature and cross-references MtPrx66 (Medtr4g114210.1[4.0] / Medtr8g120300.1[3.0])
Literature VandenBosch,K. et al., unpublished, Journet,E.P. et al., unpublished.
DNA ref. Phytozome 11:   chr4 (47050177..47048462)
EST ref. GenBank:   AL385774.1 [5' end]
Cluster/Prediction ref. Phytozome Gene 11:   31106309
Omic ref. Gene atlas:   Mtr.10248.1.S1_at   Mtr.31928.1.S1_at Legoo:   Mtr.10248.1.S1_at   Mtr.31928.1.S1_at
Protein sequence: MtPrx66 (Medtr4g114210.1[4.0] / Medtr8g120300.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 320 (301)
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
34642.81 (32658.7)  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
8.21 (7.99) Peptide Signal: %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 20 range:20-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIVKLGFLVILGMTLAVNAQLKTGFYSNSCPTAESIVRSTVVSYFNKDPTIAPGLLRLHFHDCFVQGCDGSILIAGSSSERSALPNLGLRGFEVIDNAKSQIEAICPGVVSCADILALAARDAVDLSDGPSWPVPTGRKDGRISLSSQASNLPSPLEPVSVHRQKFAAKGLNDHDLVTLLGAHTIGQTDCRFFSYRLYNFTTTGNADPTINQAFLAQLKAICPKNGDGLRRVALDKDSPAKFDVSFFKNVRDGNGILESDQRLWEDSATRRVVENYGGNFRGLLGLRFDFEFPKAMIKLSSVDVKTGIDGEIRKVCSRFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 3 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTGTTCAGG TTGTGTTGTG ATGAACTATA TATCAAAAGC TAGCATTTGT GCTCATCACT CGTGGAAATC GTTGTGTTAA ATAAATATTT GTTTAGTTTT TTCTTGTATG ATTTGTATAT  TACATCTAAT TCTCAATAGA AGAAACTAGT GCAGCTGTTC CTGATGTGGC TTTCAGTTTG TCTTTTGTGT CATGTTATGT ATTGTTGTTT TTTGTTTCAG TTGCTAAGCT TGTCTCTGTG  TTATAAGGAA GCCAAAATCT AACGTAGTTA TTCCTCTTCC TGATGTCAAT GTCAATTCTT GTTACAATTT AGCAGCAAAT ATATAGTACT GTCTCATAAT TTTAATTTGT CTGAAACATG  AACAAGATTA ATTGGTTTTG TTGTTTCAAA AGCAAAAAAA AAAAGGGGAA ATATCATTTT TTTTAAATTC TAATTTTCGC ACAACGAAAT TTTTAAAAAT ATATTCCGAT TGTTGAGGTT  GTTGTCTCCA AGCTGAGTTC AGATAAAAGA AGGTAGCAAA CCAAACTACC TACCCGAATA GCCAAAATAA ACTGAACAAC TAATCTAATC ATTATTAGTA ACACTTAAAT AACTCCAATT  AATAACTCAT GTTAATTCAT GTTATGTCTA GAAGCTGATG TTTTAATTAA GTAGTCAAAA TTGATTGTTA TTCAACTTTA TTTATTTATT TTCTGCTTAG TTCTTAACGG TTAATGCATG  GCTTCAAATC TTCCTCCTGG ATTCTGAATT TTTCACGCAT GATCCAATAA TAACTAACAA GTGGTGCTGT GCTCACTGAT TAATGCACAA CATCAATCAA GGGAAAATCA AGAAAAGGTA  AAGTTATTTC TGCATAAAAA CGTGTGGGGT AGGGAAAAAC AGAAATTTCT TTGGCACTTA TACGACTTCA ATGTTATGCA TTTACTCAAG GTCTCGGGTT CAATCCCCAT GGTGTCAACA  ATTCCTGTAT TTGGTCAGTC CATACAAAGA TCTGAGTTCA ATTGAGCTCC GCTAATGGGC GATGGAATTT TCTTCTGGAT TAGTTGGTAT TGCTGGATTA GCTTCTCATA AATATATACG  ATCAAAAATT CTAAAAAGAT ATGCTACTTA ATAAGCATAA AACAGTAAAT TAAATGGTAA ACAATAGCAA AATAAATTAA TAACTCTTTT TAGATATTTA GCCATATTTT TTTACAGGCT  ACATATTTAA CCATTAAGAG TGGAAATTTA GAAGCAATAT ATCATGACTT GATTCAACCA TTAGTAGTGA TCATCTGACT GTTATTCAAC TATTACATTT TTCTTTTCCT AGTGCTTGAT  AGTTAATAGA AAAAAACTTT AATTTGCTGC TCCATTTACA ATTTTGTAAG AAAGTCATGG ATACCTAATA ATTTTGAATT AATTACATGA AGCAACTAGT ATGAACGAAA CCACAACAAG  TAAAATACTG AAAAGAAAAA AGTTGTGCAC CAAGGGCAAG TATAAGAAAT AGAAAAAGCA GAAACGCGTT GAGGAATAAA GCAAATGCAT CACAGATAAG AAGAGACAAA AGAGTGATGG  AAACACCTCC CTAGGTTTCG AATCTCTAAT ATAATATGAA CTTAAGAAAA ACACAAGCAT CTTTTAATTT ATGATTGTGT TATTTGAACG TCAAAATATA GACACGTGAC ACCCTATATA  TTTTATCTCG ATGACTTGCA CACATTTCAA AAGTACACAT AAAAAATAAA AGACAATGTT TTTTAATATA TCTCCACTAT ATGAAAATGT ATTTGGCTAA TTGGCCAATG TCTTATAATC  CACTTTCCTA ATAAAATAAT TGAGAAAAAC TCAATCATAT ATAGTGATAT CTACTTTTTG CTACAGAGAA ACCATTATAT ATAACTGACA ATCACTAGTG ACACAAATGC TCTGCTAGCA 
AGGGAGTGAG AGAACCATAA AAAACCAAGT GTGGAGTTGT ATCTGAATAC TTGTTTCAGT TTGCATTGTG TTCGTACAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATTTGTGT CTGTTGTGAC TAGTTTCTGT TTTGGACAGA GAAAATCAAG AAAAGGCTAA AAAAATATGC TACTTCATGC ATGACAGTAA ATAAGTGCCT AAACAATATC ATAATGAAAT  AATTTATGTT CTTGAAACGA GAACGCTAGT TCCAACTAAG ACTGCTATAT TCAATGTTTC ATAACCAATT GGTCATTGTT TTTTTCATTA GTACTCTCAA GTGTTTTGGT GCAGATTGAA  ATCACTGTGG TCTGTGGGTT TGACGAAATC ACAGTGCAAT TTGATATTAC TGAAGCTAAG CTCTAAAATG TAGCTTTTAT AAATCATGGT GTCGTGATTT TGTCAAATTC AACGCGGATT  CAAACGGACT TTTAGTTAAG TAGCCATCAT ATAATTGTCA TTCAACTAAC TAGAGATACA AATTCTATCA ACGTTACGCT GTAATTAGAA TCTCGTTCTC ATCAGGTCCG GTCCAAAAGA  CAGGCCACCT CAATTTTTTT TTACCAAGCA TGTGCATTTA TATCAACTGA AAAAATGCTT CATCTTTTAA ATTAATCTGC ATGCCTCATA GCCACTAAGC TCTGGATATT GAAAACAAGT  CAACACTTTT TTTTTCATCT ACTCAACCTT GAAAAGTGCA AATGAATATG TCAAATAAAA TTTTATTTTT TCATTTGAGG GGGATCACAC ATATTCCGCA GTTAGTTGAG TTTCCGGTTC  TCCAATAGAT TGACTAGCAA TTATACTTTT TTTAGGATGA TAAATATTTT CCTTTTCATC TTTTATTATG CAACTATCTT ATATCATGTC AAGTAAATTT ATATTGTTTA TAAAAAATTT  AAATCTTAAT AAATAATTTT GTATAAAAAA ATACATCTTT TTATAATAAT ATATTTTCCA ACAAGCCTTA TTTTGAAATT CATCTTGAGC CTTCACTTTT ATTTTTCACT TTTTTGGATA 
GGTTTTCTAA AAAAACATTT TTTTTTGGAA AGTGTATTCT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTGTGAAATTGGGCTTCTTGGTGATTTTGGGGATGACTTTGGCAGTAAATGCCCAACTGAAAACTGGGTTTTATTCAAATTCATGTCCAACAGCTGAGTCCATCGTACGGTCCACA
GTTGTATCTTACTTTAACAAAGATCCAACCATTGCTCCTGGCCTGCTCAGACTTCATTTCCATGATTGCTTTGTCCAA
GTAAGCTAATTGTATGTCTGGATTGGCAGTGATATCGACAAA
ATCACGATGACACCGTGATTTTGTTGAAGCTTGTTGTTTAGTTTTTTGTCAAAATCATGGCAGCTTACAAAGTTCTACTAATCTCACCGTGAATCCTAACATACACTATAAAATCATGTT
ATGTATAGTTTTTCTTTTCTTTTTTTGGTCCTACGTATAGTTTTTTCTTTTACAAAGGTTATATAGTTTTTAAAATCTTTTTAAAATTTGAATCTCCTGAGGGCTATACTTGTTAGTTGA
AAAATGTCTTGGTTAAAACTGTAAAAAATAAATAATTACATAGTAACTTATGAAATTATGCGAGTATATCATGATTGGTAAACTTTTTTGCTTGAATACTAGTTAGTGTCTATGTACATT
ATTTTTGTCTGATTTATTTTGATATACAAATTTAAAGTCCATTTGACAATATATCTTCTCTCCCACTCCCATAGGGCTGCGATGGATCCATATTGATTGCAGGCTCTTCATCAGAAAGGA
GTGCATTACCAAACCTTGGTCTAAGAGGTTTTGAAGTGATAGATAATGCAAAATCACAAATAGAGGCCATATGCCCTGGTGTTGTATCATGTGCTGACATCCTAGCATTGGCAGCTCGTG
ATGCTGTCGATTTG
GTATTAAAGCAATCTTAAAACTTAGTCAAACTCACTCTACTCCACGCGCGCGCGCCCGCACAATACATTTTGTTTTTGAAGTAACCATGATAAAATTAACACGTGT
GATTCGTGAATATGACAGAGTGATGGCCCAAGTTGGCCAGTGCCCACAGGAAGAAAAGATGGAAGGATTTCTTTATCATCTCAAGCCTCAAACTTGCCTTCTCCGCTTGAACCTGTTTCT
GTCCATCGACAAAAATTTGCTGCCAAAGGTCTAAATGATCATGACCTTGTTACCTTACTTG
GTATGCTTTCTTTCAAAACTTTTAATCTATAAACGAAATTGGACTAACAACAACGAAAA
AATAAAGTTAGTCTCTAATTACTTTTCTTATATGTTCCTAGCATTTGCTACACATTTATTTATGTATTAACCTAAACTCTTGATTTTTGTGAAGGTGCACATACCATTGGCCAAACAGAT
TGCAGGTTCTTTAGTTATCGTCTATACAATTTCACAACCACTGGCAATGCTGATCCTACTATAAACCAAGCTTTCTTAGCCCAGCTTAAAGCAATATGTCCAAAAAATGGAGATGGTTTG
AGAAGGGTGGCTTTGGACAAAGATAGTCCAGCCAAATTTGATGTAAGTTTCTTCAAAAATGTACGCGATGGTAACGGGATTCTAGAGTCAGACCAGAGGCTGTGGGAAGATTCTGCTACA
AGAAGGGTGGTGGAAAATTATGGTGGGAATTTTAGAGGGTTATTGGGGTTAAGATTTGATTTTGAATTTCCAAAGGCTATGATTAAGTTGAGTAGTGTAGATGTGAAGACTGGTATTGAT
GGAGAGATTAGAAAAGTGTGCTCAAGATTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTGTGAAATTGGGCTTCTTGGTGATTTTGGGGATGACTTTGGCAGTAAATGCCCAACTGAAAACTGGGTTTTATTCAAATTCATGTCCAACAGCTGAGTCCATCGTACGGTCCACA
GTTGTATCTTACTTTAACAAAGATCCAACCATTGCTCCTGGCCTGCTCAGACTTCATTTCCATGATTGCTTTGTCCAA
GGCTGCGATGGATCCATATTGATTGCAGGCTCTTCATCAGAA
AGGAGTGCATTACCAAACCTTGGTCTAAGAGGTTTTGAAGTGATAGATAATGCAAAATCACAAATAGAGGCCATATGCCCTGGTGTTGTATCATGTGCTGACATCCTAGCATTGGCAGCT
CGTGATGCTGTCGATTTG
AGTGATGGCCCAAGTTGGCCAGTGCCCACAGGAAGAAAAGATGGAAGGATTTCTTTATCATCTCAAGCCTCAAACTTGCCTTCTCCGCTTGAACCTGTTTCT
GTCCATCGACAAAAATTTGCTGCCAAAGGTCTAAATGATCATGACCTTGTTACCTTACTTG
GTGCACATACCATTGGCCAAACAGATTGCAGGTTCTTTAGTTATCGTCTATACAATTTC
ACAACCACTGGCAATGCTGATCCTACTATAAACCAAGCTTTCTTAGCCCAGCTTAAAGCAATATGTCCAAAAAATGGAGATGGTTTGAGAAGGGTGGCTTTGGACAAAGATAGTCCAGCC
AAATTTGATGTAAGTTTCTTCAAAAATGTACGCGATGGTAACGGGATTCTAGAGTCAGACCAGAGGCTGTGGGAAGATTCTGCTACAAGAAGGGTGGTGGAAAATTATGGTGGGAATTTT
AGAGGGTTATTGGGGTTAAGATTTGATTTTGAATTTCCAAAGGCTATGATTAAGTTGAGTAGTGTAGATGTGAAGACTGGTATTGATGGAGAGATTAGAAAAGTGTGCTCAAGATTTAAT
TGA

Retrieve as FASTA