Entry information : PfaGPx01
Entry ID 3969
Creation 2006-09-06 (Christophe Dunand)
Last sequence changes 2012-06-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-08 (Christophe Dunand)
Peroxidase information: PfaGPx01
Name PfaGPx01
Class Other glutathione peroxidase    [Orthogroup: Gpx4001]
Taxonomy Eukaryota Apicomplexa Aconoidasida Plasmodium
Organism Plasmodium falciparum    [TaxId: 5833 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PfaGPx01
start..stop
S start..stop
ThasGPx02 154 3e-48 43..203 8..164
AgaGPx03 152 1e-46 33..201 50..217
BsGPx01_Marburg 148 6e-46 43..205 2..160
RsGPx03 149 9e-46 4..203 6..194
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 708..1004 297 N° 2 320..490 171 N° 3 1..150 150  
complement(join(1..150,320..490,708..1004))


exon

Literature and cross-references PfaGPx01
Literature Gardner,M.J. et al.,Nature 419 (6906), 498-511 (2002)
Protein ref. GenPept:   AAN36208 UniProtKB:   Q8I5T2
DNA ref. GenBank:   AE014846 (32944..33947)
Protein sequence: PfaGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   205
PWM (Da):   %s   23809.07  
PI (pH):   %s   9.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFFSMFIKFILPISFICYNFGKKFNMFSYFQKIKVSEQELLSSIYDYEVKDLSGSNVSMSKFKNKVLIIFNSASKCGLTKNHVEQFNKLHEKYNARGLEILAFPTSQFLNQEFDNTKDICTFNEKNKIKYNMFSPIEVNGDNTHPLFKYLKKNCDSMHDENGTLKSIGWNFGKFLVDKNGEVVNYFSPKTNPLDLEKIIIQLLQK*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (Chromosome 12, 2 introns). Isolate="3D7". Identical sequence in isolate FCR3 (NCBI Z68200, SwissProt Q27742).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTTCTCAATGTTTATTAAATTCATTTTACCTATATCTTTTATATGCTACAATTTTGGAAAGAAATTTAATATGTTTAGTTATTTTCAAAAAATCAAAGTATCAGAACAGGAATTA
TTATCATCCATTTATGATTATGAAGTAAAGGATTTATCAGGATCAAATGTATCCATGTCTAAATTTAAAAACAAAGTTTTGATTATTTTTAATTCTGCTTCAAAATGTGGATTAACAAAA
AATCATGTAGAACAATTTAATAAATTACATGAAAAATATAACGCAAGAGGATTGGAG
GTATACATAATAAAAAAATAAAAAAATAAAAAAAAAAAAAAGAAAAAAAAAAAATAAAAGAAA
AGAAAAGAAAAGAAAAAGAAAAAAATTGTAAGGTTAATTATTTATATATATATTATATTTTTTTAATATTTTTAATTTTTTAATTATGTGTAATATATATATATATATATATATATATAT
GTATAATTATTTATTTATTATTCCCTTGCTTTAGATCTTAGCTTTCCCCACAAGTCAATTTTTAAATCAAGAATTTGACAACACAAAAGATATTTGTACATTTAATGAAAAGAACAAAAT
AAAATATAATATGTTTTCACCCATTGAAGTAAATGGGGATAATACACACCCACTCTTTAAATACTTAAAAAAAAATTGTGATTCG
GTTAGTAAAAAAAAAAAAAAATTTAATTAAATGAA
CTTATATATATATATATATATATATATTTATATGTAGTGGCATATGATTTTATATTATTAATATTTTAATGAGTAAAAAAAAAATATTATTTTTTTTCCAAATAAATTATTTCATATATT
TCATTTTTTTCCAGATGCATGATGAAAATGGAACGTTAAAAAGTATCGGATGGAATTTTGGAAAATTTCTCGTCGATAAAAATGGAGAAGTTGTAAATTATTTTTCACCCAAAACAAACC
CGTTAGATTTAGAAAAAATTATAATTCAATTACTACAAAAATGA

Retrieve as FASTA