Entry information : ZmPrxQ
Entry ID 401
Creation 2009-01-15 (Christophe Dunand)
Last sequence changes 2009-01-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrxQ
Name ZmPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Mixed tissues
Seedlings
Inducer Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrxQ
start..stop
S start..stop
SbPrxQ 382 2e-137 1..218 1..212
TaPrxQ 350 1e-124 1..218 1..217
OsPrxQ 321 3e-113 1..218 1..217
LuPrxQ190 297 9e-104 34..218 30..211
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 107735463..107735672 210 N° 2 107735770..107735907 138 N° 3 107736296..107736604 309  
join(107735463..107735672,107735770..107735907,107736296..107736604)


exon

Literature and cross-references ZmPrxQ
Literature Journet,E.P. et al., unpublished
DNA ref. GenBank:   AC212457.3 (23096..21955)
Cluster/Prediction ref. UniGene:   Zm.43088
Protein sequence: ZmPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   218
PWM (Da):   %s   23269.06  
PI (pH):   %s   10.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTPATACCKASLALAPRASPRGPAACAQAALLCTPSTSVFRGLRAPASAAPAPRRRRSAASTGIVCGKVAKGSVPPNFTLKDQNGKPVSLNKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKAFAQKYRLPFTLLSDEGNRVRKEWGVPSDLFGTLPGRQTYVLDKQGVVQYVYNNQFQPEKHIGETLKILQTL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 2 introns) and 79 ESTs. Also found in AC208541.2.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCACGCCCGCTACGGCCTGCTGCAAGGCTTCCCTGGCGCTGGCACCGCGGGCGTCGCCCCGCGGCCCGGCGGCCTGCGCGCAGGCGGCGCTCCTCTGCACGCCCTCCACCTCC
GTGTTCCGCGGCCTCCGGGCGCCCGCATCCGCCGCGCCGGCCCCGCGCCGGCGCCGCTCGGCGGCGTCCACGGGCATAGTCTGCGGCAAG
GTACGTGGCCTCGGGAATGGCGTGCGTGCG
TGCGGGAATCCGTGTTCCACACATGGCGGTGATTGGTTTGGTAGCCGTGGTCGTCTCCTCGTTGCAGGTCGCCAAGGGCAGCGTGCCGCCGAACTTCACCCTCAAGGACCAGAACGGCAA
GCCCGTGTCGCTGAACAAGTTCAAGGGCAAGCCCGTCGTGGTTTACTTCTACCCCGCCGACGAGACGCCCGGATGCACAAAGCAG
GTCAGCTTCTTAAGCAAATGTCGGCACTTTACTGA
AACTCTGGAGCCGTCTGTTATTAATTCCAAGAAATAGTAAGAAACTCTGAAACTGTGGCGAGTAGTGCTCCTGCAAATTAAAGGCAAAAGCTTTCTCATTTTGTAGAATGGAAGCACCCA
TTGAAGACTAAGGTTTTGTTGGATTGGACTTTTGGGGACTGGTTTTTTGCTTTCTAAAAACCAAAGATCTAACCAAAAAAAAAGGCTATTTTTAAAGTCTGCTTTTCCAGAAAACAACAA
CAGACACCAACCAAACTGAAAACTGGGCCTCAAACTGAAACCTCCGTCCATGATCCATCCATCCTCTATTATTATTATTATTATAAAAAGAAATGGCGGTTTGGTTGATGCAGGCGTGCG
CGTTCAGGGACTCGTACGAGAAGTTCAAGAAGGCCGGGGCGGAGGTGATCGGCATCAGCGGCGACGACGCGGCGTCGCACAAGGCGTTCGCGCAGAAGTACCGGCTGCCGTTCACGCTGC
TGAGCGACGAGGGGAACCGCGTGCGCAAGGAGTGGGGCGTCCCCTCGGACCTGTTCGGGACGCTGCCGGGGCGCCAGACGTACGTGCTGGACAAGCAGGGCGTCGTGCAGTACGTCTACA
ACAACCAGTTCCAGCCCGAGAAGCACATCGGCGAGACGCTCAAGATCCTGCAGACCCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCACGCCCGCTACGGCCTGCTGCAAGGCTTCCCTGGCGCTGGCACCGCGGGCGTCGCCCCGCGGCCCGGCGGCCTGCGCGCAGGCGGCGCTCCTCTGCACGCCCTCCACCTCC
GTGTTCCGCGGCCTCCGGGCGCCCGCATCCGCCGCGCCGGCCCCGCGCCGGCGCCGCTCGGCGGCGTCCACGGGCATAGTCTGCGGCAAG
GTCGCCAAGGGCAGCGTGCCGCCGAACTTC
ACCCTCAAGGACCAGAACGGCAAGCCCGTGTCGCTGAACAAGTTCAAGGGCAAGCCCGTCGTGGTTTACTTCTACCCCGCCGACGAGACGCCCGGATGCACAAAGCAG
GCGTGCGCGTTC
AGGGACTCGTACGAGAAGTTCAAGAAGGCCGGGGCGGAGGTGATCGGCATCAGCGGCGACGACGCGGCGTCGCACAAGGCGTTCGCGCAGAAGTACCGGCTGCCGTTCACGCTGCTGAGC
GACGAGGGGAACCGCGTGCGCAAGGAGTGGGGCGTCCCCTCGGACCTGTTCGGGACGCTGCCGGGGCGCCAGACGTACGTGCTGGACAAGCAGGGCGTCGTGCAGTACGTCTACAACAAC
CAGTTCCAGCCCGAGAAGCACATCGGCGAGACGCTCAAGATCCTGCAGACCCTCTGA

Retrieve as FASTA