Entry information : ZmPrxQ
Entry ID 401
Creation 2009-01-15 (Christophe Dunand)
Last sequence changes 2009-01-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrxQ
Name ZmPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Mixed tissues
Seedlings
Inducer Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrxQ
start..stop
S start..stop
SbPrxQ 382 2e-137 1..218 1..212
TaPrxQ 350 1e-124 1..218 1..217
OsPrxQ 321 3e-113 1..218 1..217
LuPrxQ190 297 8e-104 34..218 30..211
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 107735463..107735672 210 N° 2 107735770..107735907 138 N° 3 107736296..107736604 309  
join(107735463..107735672,107735770..107735907,107736296..107736604)


exon

Literature and cross-references ZmPrxQ
Literature Journet,E.P. et al., unpublished
DNA ref. GenBank:   AC212457.3 (23096..21955)
Cluster/Prediction ref. UniGene:   Zm.43088
Protein sequence: ZmPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 218
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
23269.06  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
10.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTPATACCKASLALAPRASPRGPAACAQAALLCTPSTSVFRGLRAPASAAPAPRRRRSAASTGIVCGKVAKGSVPPNFTLKDQNGKPVSLNKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKAFAQKYRLPFTLLSDEGNRVRKEWGVPSDLFGTLPGRQTYVLDKQGVVQYVYNNQFQPEKHIGETLKILQTL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 2 introns) and 79 ESTs. Also found in AC208541.2.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCACGCCCGCTACGGCCTGCTGCAAGGCTTCCCTGGCGCTGGCACCGCGGGCGTCGCCCCGCGGCCCGGCGGCCTGCGCGCAGGCGGCGCTCCTCTGCACGCCCTCCACCTCC
GTGTTCCGCGGCCTCCGGGCGCCCGCATCCGCCGCGCCGGCCCCGCGCCGGCGCCGCTCGGCGGCGTCCACGGGCATAGTCTGCGGCAAG
GTACGTGGCCTCGGGAATGGCGTGCGTGCG
TGCGGGAATCCGTGTTCCACACATGGCGGTGATTGGTTTGGTAGCCGTGGTCGTCTCCTCGTTGCAGGTCGCCAAGGGCAGCGTGCCGCCGAACTTCACCCTCAAGGACCAGAACGGCAA
GCCCGTGTCGCTGAACAAGTTCAAGGGCAAGCCCGTCGTGGTTTACTTCTACCCCGCCGACGAGACGCCCGGATGCACAAAGCAG
GTCAGCTTCTTAAGCAAATGTCGGCACTTTACTGA
AACTCTGGAGCCGTCTGTTATTAATTCCAAGAAATAGTAAGAAACTCTGAAACTGTGGCGAGTAGTGCTCCTGCAAATTAAAGGCAAAAGCTTTCTCATTTTGTAGAATGGAAGCACCCA
TTGAAGACTAAGGTTTTGTTGGATTGGACTTTTGGGGACTGGTTTTTTGCTTTCTAAAAACCAAAGATCTAACCAAAAAAAAAGGCTATTTTTAAAGTCTGCTTTTCCAGAAAACAACAA
CAGACACCAACCAAACTGAAAACTGGGCCTCAAACTGAAACCTCCGTCCATGATCCATCCATCCTCTATTATTATTATTATTATAAAAAGAAATGGCGGTTTGGTTGATGCAGGCGTGCG
CGTTCAGGGACTCGTACGAGAAGTTCAAGAAGGCCGGGGCGGAGGTGATCGGCATCAGCGGCGACGACGCGGCGTCGCACAAGGCGTTCGCGCAGAAGTACCGGCTGCCGTTCACGCTGC
TGAGCGACGAGGGGAACCGCGTGCGCAAGGAGTGGGGCGTCCCCTCGGACCTGTTCGGGACGCTGCCGGGGCGCCAGACGTACGTGCTGGACAAGCAGGGCGTCGTGCAGTACGTCTACA
ACAACCAGTTCCAGCCCGAGAAGCACATCGGCGAGACGCTCAAGATCCTGCAGACCCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCACGCCCGCTACGGCCTGCTGCAAGGCTTCCCTGGCGCTGGCACCGCGGGCGTCGCCCCGCGGCCCGGCGGCCTGCGCGCAGGCGGCGCTCCTCTGCACGCCCTCCACCTCC
GTGTTCCGCGGCCTCCGGGCGCCCGCATCCGCCGCGCCGGCCCCGCGCCGGCGCCGCTCGGCGGCGTCCACGGGCATAGTCTGCGGCAAG
GTCGCCAAGGGCAGCGTGCCGCCGAACTTC
ACCCTCAAGGACCAGAACGGCAAGCCCGTGTCGCTGAACAAGTTCAAGGGCAAGCCCGTCGTGGTTTACTTCTACCCCGCCGACGAGACGCCCGGATGCACAAAGCAG
GCGTGCGCGTTC
AGGGACTCGTACGAGAAGTTCAAGAAGGCCGGGGCGGAGGTGATCGGCATCAGCGGCGACGACGCGGCGTCGCACAAGGCGTTCGCGCAGAAGTACCGGCTGCCGTTCACGCTGCTGAGC
GACGAGGGGAACCGCGTGCGCAAGGAGTGGGGCGTCCCCTCGGACCTGTTCGGGACGCTGCCGGGGCGCCAGACGTACGTGCTGGACAAGCAGGGCGTCGTGCAGTACGTCTACAACAAC
CAGTTCCAGCCCGAGAAGCACATCGGCGAGACGCTCAAGATCCTGCAGACCCTCTGA

Retrieve as FASTA