Entry information : AtPrxQ (At3g26060 / PRXQ / Thioredoxinreductase)
Entry ID 4015
Creation 2006-10-30 (Jean-Pierre Jacquot)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrxQ (At3g26060 / PRXQ / Thioredoxinreductase)
Name (synonym) AtPrxQ (At3g26060 / PRXQ / Thioredoxinreductase)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation Chloroplastic
Tissue type Leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrxQ
start..stop
S start..stop
AlyPrxQ 400 2e-144 1..216 1..216
AhalPrxQ01 360 4e-129 40..216 1..177
ThasPrxQ01 330 5e-117 3..216 2..216
AdePrxQ 301 2e-105 6..212 4..210
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9524807..9525010 204 N° 2 9525492..9525629 138 N° 3 9525722..9525811 90 N° 4 9525905..9526123 219
join(9524807..9525010,9525492..9525629,9525722..9525811,9525905..9526123)


exon

Literature and cross-references AtPrxQ (At3g26060 / PRXQ / Thioredoxinreductase)
Literature Lamkemeyer et al Plant J 2006, Rouhier & Jacquot Free Radic Biol Med 2005
Protein ref. UniProtKB:   Q9LU86
DNA ref. Phytozome 11:   Chr3 (9524807..9526123)
Cluster/Prediction ref. Phytozome Gene 11:   19659138 UniGene:   At.20459
Omic ref. TAIR:   At3g26060
Protein sequence: AtPrxQ (At3g26060 / PRXQ / Thioredoxinreductase)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   216
PWM (Da):   %s   23592.23  
PI (pH):   %s   10.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSSSFTLCNHTTLRTLPLRKTLVTKTQFSVPTKSSESNFFGSTLTHSSYISPVSSSSLKGLIFAKVNKGQAAPDFTLKDQNGKPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLKAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 5 cDNA and 97 ESTs Incorrect prediction from Phytozome (splicing error).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CATGTCAATC AGCTGTGTTT CTTCTAGTAA TACCGAGAAA ACTATTGTGG GGAGGCCCCA GAACGGTTCT AGGAGTGCAG TGAAAGCAGA CAAGAAGAAG AGATCAGGTC CAAGTTCAGT  TCACATGTCA CTCAATTTTG CTTCTTCTAC TCTTCGTACG ACCAAAGAAG CCCCAAAAAC ACTGGCAAGA AACTCCACTA CACAGGGAAC AACTTCAACA AATGCTAGAA ACAAACTTTT  CCCAAAGATA AACGAACCAA CGGGAGCTTT AAAAAGCTGC AAGAGACCAT TGTCTCAGAC ATCCAAAGAC GGTTCAACCA ATGTAATTCT CTTCCCAAGT TTCTCTTCTT GCGTATATCC  CAAGCATATT TGCTGAGACT GACTCTTACA TATATTGCAG GCCTCTGCTG TCACGTTACC CAGACTTCCT CTTCTCAGTA ATCTGCTATC AGAAAACAAA AGGTTACTGA TCAAACCATC  TTCAACACCA ATTCATCGCT TTATACTATT ACTTTATTAT TAACTCAACC CTATAATTAA CTTTGCTTCT TCTGATATAC AGGAAAAACA TATCTGTAAG GAGTTCAGTT TCATGTAGAA  TATCCAACAA TGAGCAAAGA AAACCTTCTG TCGGGTAAGC GGTTTAAGTA CCAACCTCTT AGAGAAATAC TATCTTATGT CACTTACTGC AAATGGCCTG AGTTGGTTAA TTGAAAGTGT  TTGTGTTAGT TCCCTGATTT ATGTGGACAT AAGACGAGAT GTTTTTGTCT AATGCATTTT GCAGCTGTGA AAATCTGTCA ACTCATAGCA GAACCAAAGC AAAGTCTTTG ACTGTATCTT  CTCCCTTCGT CTTCAGAAGT GATGAAAGGG CAGAGAAGAG GAAAGAGGTA GAACTAAAGA AGATCCTTTT ACTTTATCTT TGAGATTATT TGAGGACTTA TAGAGCCGTA GTTTAAAAAA  GATCTCTTTT GTTGTGGATG TGTCTTGTCT GTTAGTTCTT CAAGAAAGTA GAGGAAAAAA ACAAGAAAGA GAAAGAGGAT AAATTTTCTT GCGGCTTCAA GGCAAATCAA AACACTAACT  TAGCATCTGA AGAACACAAG AACCCACAAG TTGGTGGTTT TCAGGTATAT TCAACTCTCA GACTGTAACT TGTCATAAAT TTGGGTATTG AATCTTTGAT GTATGACATT ATAATCATGT  GCAGGTAACA CCGATGACCC TGACTTCACC AAGATTCCGC AGGAACCAAA CTCCAGGAAA AGAGAACATA AAAAAACCTC ATCAAACTCC TCATAAAGCT TCCTCAATGA AGATCATCAA  CACCAAAAAA GTAGTCATGG AGAAGCACAA AAGCAGCAAG ATCCATCCCT CCTCCAAACA GCAGACAACA AAAAGAACTC AAGAAAATAT GTCTCCTAAT ATTCTTCAGA ACTAACCAGA  GACAAACCAG ATCAATCGAT TCCTCTTCTT CAAGTCTCTA GATCATCGTA AAGATTCGAC TTTTCACTTT GAAGATTCCG AAAGTTTTGT CCCTTCAGCT AGTAATCTCA TCTCAAGCTT  ATGGTTTAGG TGACTAGCCC TTGATTCAGA TTGTGTAACC ACAAGCTTTT AAGGAGCTGT GTAGAATAGA TAGAACTCAA GTCTACTTAC TCTTCAAAGT AACTATGTAC TCAATAGTTC  TGTAGTATCA ATCTTGTATC ATTTGTATAC ATAGAGATTT GAAATAAAGA ATTATGTCTA CTTTTCAATT TCTCATTGTG TTTCTTTCTT GAATTAGTAT AGACAGGAAC ATGGCAAAGC  TTTCTGTTTT ACATTTGTTT TAAACGACGA CGTTTTGGTA TGATGTTGTG ATGTTGTGTT GTTGTGGTGT GGGCCTCTCG TTTCAGAGGT GAGAGAAAAA ATCTTATCTC TGTGGACTGT 
GATTGTGTGA TGTTTCCATA TCTTCAGCTT TTCTTCTACT ACATGCTCTA ATCACGTCCT TGTAGAGGAA AAGAAAAAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATTCTCTC TTTCTCTTCT TTCTCTTCTT TCATGCATGT CTCATGTCTG TCTCCATGAG ACCATGACCT TCTTATATTG TTTCTGTTGA GTATGAATTT TCAATAATAC CATGTTATAC  CAATGAGAAG GGAGTTGGCT TTGGTCTAGT ACAAAGATCA CAACAGGATA AGTACTGAAG TGTGGTTAAA ATGTTAGTTG GTTCTGTGTA TTTGAGTCTC TCGTTTTCAT TGTGAACACC  TCTACTATCT CTTTCTCTTG TATCAATTAA CACTTCAAGT AAGGTACACA TATCAGGTAA CTCTAGCTAG CCCTTGATTA AAATTGTCAA ACACAAAGCT TTAAGGAATT GTGTAGAATA  CATAGAACTC AAGTCTTCAC ACAATAGTTT TAGTATGTGA ACTCAAGTAC TCAATAGTGT TGTGGTCTCA ATCTAATATT TGAAATTTAA AACGGTTATT TTCGCATTGT GTTTCTTTCT  TGATTTGAGT ATAGACAGGA ATAAAGGTAG AGCCTTTGGA CTGTATGAAG AATATGGCAA AGCTCTGTTT TTTTACGCAT TTGTATTAAA TGACGTCGTA TAAGTCGGAG CACCGAGGGC  CTCTCGTTTC ATGAGAGAAA CAAAAAATCT TATCTTTCTG ACAACGGTGG TGGTGTGTGA TGTTGTCAGC CATGGCAAAG ACAGAGCTAC AACGATCTCT CTCTCTTTTC TTCTTCTTCT  GTGTCTGTCT TTAAATAGAG TCTCTTTGAA ACGAAGCAGC TTTGTCCTGT TCTGATATCC ATGGCTTTAC CTTCGTGCTT AAAGACTGGA GCTTTAATGT CTCCGGCCAC TGGATTTAAT  TTTTCCGGCA GTCTTATGAA GTCAGACAGC GGCTTCGCCG TTCCGACAAA GTTACAGAGT ACTCGAAAAG GTGATCGAGA GAGATTGAGA GTCCAAGCTA TTTTCAGTTT CCCTCCTGCG 
TTTCTGACAA GAAACGGTCG AGCTGAGAAA CAGAAACAGC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCATCTTCCTCTTTCACTCTCTGTAATCACACCACACTTCGTACTCTCCCTCTGAGAAAGACCCTTGTCACCAAAACCCAATTTTCAGTTCCCACAAAATCATCAGAATCT
AACTTCTTTGGCTCCACACTCACTCACTCATCGTATATCTCCCCAGTCTCTTCCTCTTCTCTCAAAGGCTTAATCTTTGCCAAG
GTACATTTCTCGACTCTTGCATTGATAGATTGTTTG
CTACAGTTGGGTAACAACTAGTTCTGGGAATTAGCTTCTTTGTTAGACCAATGTTTTTTGGACAATCTAAGTTCTGTTCCATTTCTTTTTTATATGTTTTTGAGTATTACGATATAAATA
TTAGCAAGACAATAGATTGTTAGATACACAGCCATTTTTGAATAAGAAACAAAAGATGTAAATATTGGGTTTTAAGTCTGAATTTAAATGTTATAAGAACAGATTTATGAATGTGTTAGT
GCAGAATCAAAGACAAAATCAAAGAAACTTGTAATCAGTGTTTGTTTTAGAGACCATAAACTTTCACATACCTGAAAATAAGCAAATGCTAGAATGTTCTTGAATATGTTCAATCCTTTA
TTCATATGATTTAAGCTGACACGGCATATGAACTCTCTTTAACCTTCTGTGAATTGGTCTCTTTGTGATGTTTGGTGGGCAGCAGGTTAACAAGGGTCAGGCTGCACCAGACTTCACACT
AAAGGATCAAAACGGAAAGCCGGTGAGCCTCAAAAAGTATAAAGGGAAGCCTGTTGTTCTCTACTTCTACCCTGCAGATGAAACCCCTGGCTGCACCAAGCAG
GTTGTTAAATCTTTACT
TTCTCCTCCTTCCCGCATTCATTGATCGCATATTTAGTGTTTCTAAACGTAAATGGTTTTACTTGTGTACAACAGGCTTGTGCTTTCAGAGACTCTTATGAGAAATTCAAGAAAGCTGGT
GCAGAGGTCATTGGCATTAGTGGAGATGACTCTGCTTCTCACAAG
GTACACACATCAAAAATCTCTGGTTTCTTGAATAAACCCATTTCTTTTTTCCGGATTTTAAAGAGAGTGGTGGGA
CTTTAAACATTGTTGCAGGCGTTTGCAAGCAAATACAAACTACCGTATACATTGTTAAGCGACGAAGGGAATAAGGTGAGAAAAGATTGGGGAGTGCCTGGAGACCTGTTTGGAGCATTG
CCAGGGAGACAGACTTACGTTCTTGACAAAAACGGTGTTGTTCAGCTCATCTACAACAACCAGTTCCAGCCTGAGAAACACATCGACGAGACCTTGAAGTTTCTCAAAGCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCATCTTCCTCTTTCACTCTCTGTAATCACACCACACTTCGTACTCTCCCTCTGAGAAAGACCCTTGTCACCAAAACCCAATTTTCAGTTCCCACAAAATCATCAGAATCT
AACTTCTTTGGCTCCACACTCACTCACTCATCGTATATCTCCCCAGTCTCTTCCTCTTCTCTCAAAGGCTTAATCTTTGCCAAG
GTTAACAAGGGTCAGGCTGCACCAGACTTCACACTA
AAGGATCAAAACGGAAAGCCGGTGAGCCTCAAAAAGTATAAAGGGAAGCCTGTTGTTCTCTACTTCTACCCTGCAGATGAAACCCCTGGCTGCACCAAGCAG
GCTTGTGCTTTCAGAGAC
TCTTATGAGAAATTCAAGAAAGCTGGTGCAGAGGTCATTGGCATTAGTGGAGATGACTCTGCTTCTCACAAG
GCGTTTGCAAGCAAATACAAACTACCGTATACATTGTTAAGCGACGAA
GGGAATAAGGTGAGAAAAGATTGGGGAGTGCCTGGAGACCTGTTTGGAGCATTGCCAGGGAGACAGACTTACGTTCTTGACAAAAACGGTGTTGTTCAGCTCATCTACAACAACCAGTTC
CAGCCTGAGAAACACATCGACGAGACCTTGAAGTTTCTCAAAGCTGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTGATTGTGT GATGTTTCCA TATCTTCAGC TTTTCTTCTA CTACATGCTC TAATCACGTC CTTGTAGAGG AAAAGAAAAA AAATGGCTGC TTCATCTTCC TCTTTCACTC TCTGTAATCA  CACCACACTT CGTACTCTCC CTCTGAGAAA GACCCTTGTC ACCAAAACCC AATTTTCAGT TCCCACAAAA TCATCAGAAT CTAACTTCTT TGGCTCCACA CTCACTCACT CATCGTATAT  CTCCCCAGTC TCTTCCTCTT CTCTCAAAGG CTTAATCTTT GCCAAGGTTA ACAAGGGTCA GGCTGCACCA GACTTCACAC TAAAGGATCA AAACGGAAAG CCGGTGAGCC TCAAAAAGTA  TAAAGGGAAG CCTGTTGTTC TCTACTTCTA CCCTGCAGAT GAAACCCCTG GCTGCACCAA GCAGGCTTGT GCTTTCAGAG ACTCTTATGA GAAATTCAAG AAAGCTGGTG CAGAGGTCAT  TGGCATTAGT GGAGATGACT CTGCTTCTCA CAAGGCGTTT GCAAGCAAAT ACAAACTACC GTATACATTG TTAAGCGACG AAGGGAATAA GGTGAGAAAA GATTGGGGAG TGCCTGGAGA  CCTGTTTGGA GCATTGCCAG GGAGACAGAC TTACGTTCTT GACAAAAACG GTGTTGTTCA GCTCATCTAC AACAACCAGT TCCAGCCTGA GAAACACATC GACGAGACCT TGAAGTTTCT  CAAAGCTGCT TGATCATTCT CTCTTTCTCT TCTTTCTCTT CTTTCATGCA TGTCTCATGT CTGTCTCCAT GAGACCATGA CCTTCTTATA TTGTTTCTGT TGAGTATGAA TTTTCAATAA  TACCATGTTA TACCAATGAG AAGGGAGTTG GCTTTGGTCT AGTACAAAGA TCACAACAGG ATAAGTACTG AAGTGTGGTT AAAATGTTAG TTGGTTCTGT GTATTTGAGT CTCTCGTTTT 
CATTGTGAAC ACCTCTACTA TCTCTTTCTC TTGTATCAAT TAACACTTCA AGTAAGG 

Retrieve as FASTA