Entry information : OsPrxII03 (OsPrxIIC)
Entry ID 4017
Creation 2007-01-18 (Nicolas Rouhier)
Last sequence changes 2007-01-18 (Nicolas Rouhier)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrxII03 (OsPrxIIC)
Name (synonym) OsPrxII03 (OsPrxIIC)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation Cytosolic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrxII03
start..stop
S start..stop
SpPrxII03 303 6e-108 1..162 1..162
SbPrxII03 301 4e-107 1..162 1..162
ZmPrxII03 297 2e-105 1..162 1..162
HvPrxII03 295 1e-104 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27740894..27741048 155 N° 2 27739810..27739889 80 N° 3 27739272..27739525 254  
complement(join(27739272..27739525,27739810..27739889,27740894..27741048))


exon

Literature and cross-references OsPrxII03 (OsPrxIIC)
Literature Gama et al Physiologia plantarum in press,
Dietz et al. The function of peroxiredoxins in plant organelle redox metabolism. J Exp Bot. 2006;57(8):1697-709.
Protein ref. UniProtKB:   Q9FR35
DNA ref. GenBank:   NC_008394.1 (27741048..27739275)
Cluster/Prediction ref. UniGene:   Os.2618
Protein sequence: OsPrxII03 (OsPrxIIC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17167.01  
PI (pH):   %s   5.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPVAVGDTLPDGQLGWFDGEDKLQQVSVHGLAAGKKVVLFGVPGAFTPTCSNQHVPGFINQAEQLKAKGVDDILLVVNDPFVMKAWAKSYPENKHVKFLADGLGTYTKALGLELDLSEKGLGIRSRRFALLADNLKVTVANIEEGGQFTISGAEEILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 2 introns), cDNA, 215 ESTS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCGGTTGCCGTGGGCGACACCCTCCCCGACGGCCAGCTGGGGTGGTTCGACGGGGAGGACAAGCTGCAGCAGGTCTCCGTCCACGGCCTCGCCGCCGGCAAGAAGGTCGTCCTC
TTCGGCGTCCCCGGTGCCTTCACCCCGACCTGCAG
GTCTCTTCCTCCTTTTTTCGATTTCCTCTCCCCCCTCTTTCTTGGAGACGTTATATTTCCCTGAAAAAAAAATTCCTTAAAAAAT
GGGACTTCTTTTTATCAGATCGAGAAATTTTACTGCAAAACTGAAATGTGTACTAGCTGATGTCCGGACCAAATCCAAGATTACTGCTTTATTATACAGATACTCACAATTTATGGGATT
GATTTGACGAGCTCTGAAGTCACTCCCACTTCCTTGGGTGTCAGAGTTAGGGTTAAAAATCTTGATGTGGGTTTATATATTGCTAGTTGCATGACTAAAAAGTAGACTTCGATCCACTGT
TCTGGTTTACTCCATGTGTTGTTCCCCAGCTTCTGAGCACGCGAGAGAAAATGTTATAATTTTTGGGCATCTATGCTAGAAGCAGTTAAGCCAAGATGGGTGGCAGGATATAAAAGGGAG
ATTTTGGCTATAGTTACTCCGTGGAGATTCGCTCAGAATTTCGTAAGCTGATAGCCTTTTCTTGTTGATTAATCTCCCACAGAAAATCTGTAAACCTGGATGCAGCTAACTGAACTAAAA
CAAACATTTCGAATAGAAAAAATGGAGACACGAGTCACATGACTGACAAATACAGAGTACACATTTTATCGAGAGCAAAGTGCTCATATCCAAGTGCTCCTAACTGGCTAACTTTTGTCT
TCATTCTTTAGATTAGACTGATGCTGTTGGTTTTTACTTGTACTATTTGGTTTCGATAAATTTGTGAGCTTGAAATGTTTTATCCTTCCCTTTGCCATCATCCTCTGTTGGCACTTGGCA
CCGCAGTTTTAATATATCTAGCTGCCAATTATCTCATTTTGCTGTCCCTTTTATAAGAACCCGCTGTTCTATTTTGCCATCACAGAGGTTTAAGTTGTCATATTACTTTGTTACTCGCCC
TGTTATTGTCTTCTTTTCACTTCTGAAAACCTGATGAACTGACATAATGTCTTTTATTATTATTTTTCGATGGCTATAGCAATCAGCATGTGCCAGGATTCATAAATCAGGCTGAGCAGC
TCAAAGCCAAGGGTGTAGACGACATCTTGCTTGTCAGTG
GTATGTTTCTGTCATTTGTTTCTCCATGTTCATATTCCCAAATTTAGCTTTTGTCAGAAATCTTCAGTCAATTATTTGAAC
TAAACATGGAAGGACAAAGGAAAATTTTATTCTATTTCAGATATTGTGATTTTCCCGTGTTCTCGGTAAAGTTGTGTAGGGTAGATATACTGACTGGTGTACAAAGTAGAAACACTATCC
ACTTTCTGACTGTATATAGTACCGAATCAAGGCAGCTGTGGCAGAATATGACTTATCTGTGGATCTATGATATAATTTTGCAGTTAACGACCCCTTTGTCATGAAGGCGTGGGCAAAGTC
ATACCCTGAGAATAAGCATGTGAAATTCCTTGCCGATGGTTTGGGAACATACACCAAGGCACTTGGTCTTGAGCTTGACCTTTCGGAGAAAGGGCTTGGTATTCGTTCGAGACGGTTTGC
TCTCCTTGCTGACAACCTCAAGGTTACTGTTGCAAACATTGAGGAAGGTGGCCAATTCACAATCTCTGGTGCTGAGGAGATCCTCAAGGCACTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCGGTTGCCGTGGGCGACACCCTCCCCGACGGCCAGCTGGGGTGGTTCGACGGGGAGGACAAGCTGCAGCAGGTCTCCGTCCACGGCCTCGCCGCCGGCAAGAAGGTCGTCCTC
TTCGGCGTCCCCGGTGCCTTCACCCCGACCTGCAG
CAATCAGCATGTGCCAGGATTCATAAATCAGGCTGAGCAGCTCAAAGCCAAGGGTGTAGACGACATCTTGCTTGTCAGTGTTAAC
GACCCCTTTGTCATGAAGGCGTGGGCAAAGTCATACCCTGAGAATAAGCATGTGAAATTCCTTGCCGATGGTTTGGGAACATACACCAAGGCACTTGGTCTTGAGCTTGACCTTTCGGAG
AAAGGGCTTGGTATTCGTTCGAGACGGTTTGCTCTCCTTGCTGACAACCTCAAGGTTACTGTTGCAAACATTGAGGAAGGTGGCCAATTCACAATCTCTGGTGCTGAGGAGATCCTCAAG
GCACTGTAA

Retrieve as FASTA