Entry information : OsPrxII06 (OsPrxIIF)
Entry ID 4020
Creation 2006-10-30 (Nicolas Rouhier)
Last sequence changes 2006-10-30 (Nicolas Rouhier)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrxII06 (OsPrxIIF)
Name (synonym) OsPrxII06 (OsPrxIIF)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII002]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation Mitochondria
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrxII06
start..stop
S start..stop
ZmPrxII06 332 5e-118 1..198 1..193
SbPrxII06 323 1e-114 25..198 22..193
NtPrxII06b 307 3e-108 1..198 1..193
NtPrxII06a 306 3e-108 1..198 1..193
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9120100..9120306 207 N° 2 9119968..9119997 30 N° 3 9119083..9119241 159 N° 4 9118426..9118520 95
N° 5 9117391..9117496 106  
complement(join(9117391..9117496,9118426..9118520,9119083..9119241,9119968..9119 997,9120100..9120306))


exon

Literature and cross-references OsPrxII06 (OsPrxIIF)
Literature REFERENCE 1 Gama et al., physiologia plantarum in press;
REFERENCE 2 Dietz et al., The function of peroxiredoxins in plant organelle redox metabolism. J Exp Bot. 2006;57(8):1697-709.
Protein ref. UniProtKB:   Q9SDD6
DNA ref. GenBank:   NC_008394.1 (9120306..9117394)
Cluster/Prediction ref. UniGene:   Os.115
Protein sequence: OsPrxII06 (OsPrxIIF)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   198
PWM (Da):   %s   20747.67  
PI (pH):   %s   8.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASALLRKATVGGSAAAAAARWASRGLASVGSGSDIVSAAPGVSLQKARSWDEGVATNFSTTPLKDIFHGKKVVIFGLPGAYTGVCSQAHVPSYKNNIDKLKAKGVDSVICVSVNDPYALNGWAEKLQAKDAIEFYGDFDGSFHKSLDLEVDLSAALLGRRSHRWSAFVDDGKIKAFNVEVAPSDFKVSGAEVILDQI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 4 introns), cDNA and 50 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGGCGCTGCTGAGGAAGGCGACGGTAGGCGGCTCCGCGGCGGCGGCGGCGGCGAGGTGGGCTTCCAGGGGGCTCGCGTCGGTGGGCTCCGGCTCCGACATCGTCTCGGCGGCG
CCCGGCGTGTCGCTGCAGAAGGCCCGCTCCTGGGACGAGGGCGTCGCCACCAACTTCTCCACCACCCCTCTCAAGGACATCTTCCAT
GTACGCCCCCGCCGCCGCCGCCGCCGCTAGCCC
TACACTACCCACGTTCGTCTGCTCTGCTGCTCAGCCAGGCTTTTCTGATGATCCCTCGTGTTTTTGCAGGGGAAGAAAGTGGTCATCTTCGGCCTGCCTGTAAGCTCTCCCCTCCTCTCT
TCCTCCCGAAATTCATGCGTACTCTATACATTTCGGATACCAGATGAGGACCTTCGGTTTGTTGCTTTTTGTGTGGATACACTCATCCTGAATGCGCATTGGGGATTATGGATTCGTCTT
CCTGTAGCCTCTGTCATTACAGTGACATACATTAGCCATGGGCCATGGCGAAGAGGTAGTTTGGGCATCGATTACTTCAACTTTCAAGATAAATTCCAACATTTGAAGTTAAGGAGTAGG
AAATGCCAGACTTGAGAGTAGTTCTTTTGCGGATTAGGAGTGCAGAAATTAGAAAGCCTGGTATTCGTGGTGCCCACAGGTGAAATGGTAATAGAACTCTCCATTTCTTCGATTCTTCTC
TATTCTCTGAACAGCAAACAGGGTGCTGCATCTAATCAAACAATCTAGTGAGGGTAATATGGTTTGGGGTTGCAATAGTAAAAACAAAAAGGTAAAAATTTCATGTTACTTATCCACACA
ATTCTGCTTTCAGAGCCAGCCAATAAGGCATTTCTATCAAAATTCCTAGTTGATTTCTAACTGTCTTTTAGTATTTATGAAGCTTTATATGTTTGATATCATTTGTTTATTGTCTAAATT
TTTTCATCGTTTATTCCAAATTCTTATATCCTGGAGCGATTCTCTTTCTGAATGATCTACTGATCTGATAATATAGGTGACTGTTATCTTTACCACATATTTCAGGGTGCATACACAGGA
GTCTGTTCACAGGCACACGTCCCTAGTTATAAAAATAACATTGACAAGTTGAAAGCAAAAGGGGTTGACTCTGTTATCTGTGTCTCTGTGAATGACCCTTATGCCCTGAATGGATGGGCA
GAAAAGCTACAGGCAAAAGATGCT
GTGAGTTACCATTCTATATGCTTAAATAGTAAGAAATGCATTAAACACGCTGTATGTTTTGCTAATCTAATTATATTTACTAATCATGCATGGTAT
ATTAATATCCACCTTTGTGTTTGGTGGACTTTATCCATAATACAAATGCTGAATGCTATTGTATTCTCTCCCTGCCTCAGTACTTTGTAATGATTGAAAGCTGCACATGTCTGCCAGTAA
TGTGCTTATTTCATCATATAACCTGTAAAACAGTAAATTGCAAAGCTAATTTCATGTATCTCCTCAAGTTCACCTAAATTTATTTATGTTTTTCTTCTGATTTGTTTAATGTACACTTTA
ATGTAAGAAGAAACATAAACATTCTTCAAGTATATAATAGTTATATATTCTATACTTTAAAAATAATAAGGACCAGCGTATCATAGTCTCGTACCATTGTAGATGGCTATTGTTTATGAA
TGTTTGTCCCATGAGTCCATGCAGATATAGTTCATATCAAACTTGCTCACAATCACATAATATTCAAATCTAACCATCTGCTATGATTTTGTAATATTGATACCAGATTGAATTTTATGG
TGATTTTGATGGGAGTTTCCACAAAAGCTTGGATTTGGAAGTAGACCTCTCTGCTGCTTTGCTTGGCCGCCGTTCCCACAG
GTCAATGAATTTTACTTTGGTTAACTTGGTTTATGTCCT
TAAAAAGTTAAAACTGCTGCCTGTTTTATATAATTACAATTGAACATAAAACAACGTATTTCAGTTGCCTTTTGCTTTATTTGTTTAATTAAATCATTGTGTTAAACTTATTACTTACCA
TGGGTTAACTCAAGTACTCCTTTTCCTTACTGTAGCTTTACCCTTCAAAGTGCATTGCATTCATTATCATATTTGAGCATGTTTTATGTTGTCAAGGACATTCTGCATTGGCGGCATTGC
TAATCTACACATGTTCCCTACTGTTAAACTGTCATGATTCATGACTGTAAATGATCAATTACTTCAAGCTGCATGCACATGCCTATACATGATTTAAGTGTGAGTCTTATTCAGTCGATT
TCCAATGGATTTTGCTGTTGTTGTGACAAAATTTACTGCACTGAGGCTAACCTCTCAAAAGACTCCAATAAATGAATCCAAACCACTTCCTAAGTGTCGCACTTTAGCATGCCCTTGTTA
GCTGCACAACTATCTATGGGTGCATTGAAATTTCAAACAAAAGAGCTGAGGTGCATATTTGGAACATAATTATGGTTCACCAGGTGCATGTATTGCATGTTTTTTTGTGAAGGAATATGT
AGTTGCGTGATTCCGCAAAGTTGAACATCATTCAACATTGAGTCACTTTTGAACCTCCTTGTGTGCCCCCTTTCATTTGTTGTAAATAGTACTCTGGTGACACAATGTATGCATTTGGCT
AAGCCTGAAATGCCATTCCATAATCTCCATGGACAGCTCATGCTGTGGTACACTTTTTTTTTTTGAGGATGTAATTTACATGTTTTGTCATTTAAGAGATTGTGAAATGTGACTGGTTAA
TGGATAGATTTTTCTTACTTCTCTTCTAAAAGTATTGCTGTCCGTTTTAGGTGGTCAGCCTTTGTTGACGATGGGAAGATCAAGGCTTTCAATGTTGAGGTAGCTCCTTCTGACTTCAAG
GTTTCTGGTGCCGAGGTGATCTTGGACCAAATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGGCGCTGCTGAGGAAGGCGACGGTAGGCGGCTCCGCGGCGGCGGCGGCGGCGAGGTGGGCTTCCAGGGGGCTCGCGTCGGTGGGCTCCGGCTCCGACATCGTCTCGGCGGCG
CCCGGCGTGTCGCTGCAGAAGGCCCGCTCCTGGGACGAGGGCGTCGCCACCAACTTCTCCACCACCCCTCTCAAGGACATCTTCCAT
GGGAAGAAAGTGGTCATCTTCGGCCTGCCTGGT
GCATACACAGGAGTCTGTTCACAGGCACACGTCCCTAGTTATAAAAATAACATTGACAAGTTGAAAGCAAAAGGGGTTGACTCTGTTATCTGTGTCTCTGTGAATGACCCTTATGCCCTG
AATGGATGGGCAGAAAAGCTACAGGCAAAAGATGCT
ATTGAATTTTATGGTGATTTTGATGGGAGTTTCCACAAAAGCTTGGATTTGGAAGTAGACCTCTCTGCTGCTTTGCTTGGCCGC
CGTTCCCACAG
GTGGTCAGCCTTTGTTGACGATGGGAAGATCAAGGCTTTCAATGTTGAGGTAGCTCCTTCTGACTTCAAGGTTTCTGGTGCCGAGGTGATCTTGGACCAAATCTGA

Retrieve as FASTA