Entry information : OsPrxQ
Entry ID 4021
Creation 2006-10-30 (Nicolas Rouhier)
Last sequence changes 2006-10-30 (Nicolas Rouhier)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrxQ
Name OsPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation Chloroplastic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrxQ
start..stop
S start..stop
SbPrxQ 323 3e-114 1..217 1..212
TaPrxQ 318 5e-112 1..217 1..217
ZmPrxQ 303 7e-106 1..217 1..218
CclPrxQ01 285 7e-99 56..216 54..214
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4901242..4901448 207 N° 2 4900870..4901097 228 N° 3 4899611..4899829 219  
complement(join(4899611..4899829,4900870..4901097,4901242..4901448))


exon

Literature and cross-references OsPrxQ
Literature REFERENCE 1 Gama et al., physiologia plantarum in press;
REFERENCE 2 Dietz et al The function of peroxiredoxins in plant organelle redox metabolism.. J Exp Bot. 2006;57(8):1697-709.
Protein ref. UniProtKB:   P0C5D5
DNA ref. GenBank:   NC_008399.1 (4901448..4899614)
Cluster/Prediction ref. UniGene:   Os.22674
Protein sequence: OsPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   23609.36  
PI (pH):   %s   10.49
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFAVSTACRPSLLLPPRQRSSPPRPRPLLCTPSTAAFRRGALSATTTPTPARAALPSTTGRNRIVCGKVSKGSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGVVQYIYNNQFQPEKHIGETLKILQSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic, cDNA, 63 ESTs. Alternative splicing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCGCGGTCTCCACCGCCTGCAGGCCGTCCCTGCTCCTGCCCCCGCGCCAGCGCTCGTCGCCGCCGCGGCCGCGGCCGCTCCTCTGCACGCCCTCCACCGCCGCCTTCCGCCGC
GGCGCCCTCAGCGCGACAACAACGCCAACGCCGGCGCGCGCAGCACTGCCGTCGACGACGGGGAGGAACAGGATCGTCTGCGGCAAG
GTGACGACGACGAACAATTACCCCTCCTCCTGT
CGCAGTCGCAGGAGCACGATGATGCACGCCGCCGCGTGGCTGCTGCTGCAGCAGCTGAGCCCAGCAGCAGCGCGCGTGGCGCGGGCGGCTGATGACGATTCGTCGGTGCAGGTGAGCAAG
GGCAGCGCGGCGCCCAACTTCACGCTGAGGGACCAGGACGGGAGGGCGGTGTCGCTGTCCAAGTTCAAGGGGAGGCCGGTGGTGGTGTACTTCTACCCCGCCGACGAGACCCCCGGATGC
ACCAAGCAGGCCTGCGCCTTCCGCGACTCCTACGAGAAGTTCAAGAAGGCCGGCGCCGAGGTCATCGGCATCAGCGGCGACGACGCCGCCTCCCACAAG
GTCACTACACCCTTTCTCTTT
CTCTGCACTTATAGTCTTATTATACACTTGAGTGAATTCTAATCCCTCGATAGAATTTCCTTTCGTGCAACTTTTTTCTTAAAAACAATCCAATACAAAATGTTGTGAAAAATTAAAAAA
AGAAGATAGTTTATAGAATAGTGACATTTATCGATTCATTTAAAATGAAGTTTAAATTTGACCATTAGATTAAGAAAAAAAGTTTAGATGTGCACAATAGCTACTATTCATATTTTGAAT
TTTTCGTTTTTTATATCTCGTTGTCAATGTTGTATAAGTGTTGCTAAATTCTTCTAGAATTTATCATAACCATTTGGATAGTTTTTATACTGACGTACTCTCTTAAAATCGAAATAGTTT
CCTTTTACAATGGCTTCTACCAATAGTATAATCAACGTATGATTTTTTTTAACTTTTATTTTTTAGTTTTAAAAATAGATCCTTCAAAAACTTATTTCCAAAATCTAAAACTTTTAGCCA
CACCAGCCTGTCAAACGGGACAAAACAATACTTACACGACACACATTACGGACGTGACAGTTTTGTCCTGCCATGCTAGTGAGTGGCGTGGCCAAATAACGCTGCCACACCAGCTAGACC
GGCGTGACCAAATAACAATGTCGCGCTAGATAGACCAATGTGACAGTATTATTTTGCCACGTTAATCCGACTAACGTGGCCAAAGATTTAGATTTTGTAAATAAGTTTTGAAAGGGTTTA
GTTTTAAAATTAAAAAGTTGAAAAGTTTAAAAAGTAAGAAAATATTGTATGCATAGACCGTTCATCAATCACACACACACATATATATATATATATATATATAAACTACTTCTCCCGTTT
TAAAATATAAGCATTTTGTTAAGATTCATAGCTAGAAAATATTTATATTTTGAGATACAGATTATATCATCTTTTAATAACTGGCAATATAGTTCTGTAAATAATTAGCGATGATCAAGA
TGACAAGATCGGTTGTACCGGTGATAATAATGCGATGGAAGTTATTGATGGATGTGTAGGAGTTCAAGAAGAAGTACAAGCTGCCGTTCACGCTGCTGAGCGACGAGGGGAACAAGGTGA
GGAAGGAGTGGGGTGTGCCGGCTGACCTGTTCGGGACGCTGCCGGGAAGGCAGACGTACGTGCTCGACAAGAACGGCGTCGTCCAGTACATCTACAACAACCAGTTCCAGCCCGAGAAGC
ACATTGGCGAGACCCTCAAGATCCTCCAGAGCCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCGCGGTCTCCACCGCCTGCAGGCCGTCCCTGCTCCTGCCCCCGCGCCAGCGCTCGTCGCCGCCGCGGCCGCGGCCGCTCCTCTGCACGCCCTCCACCGCCGCCTTCCGCCGC
GGCGCCCTCAGCGCGACAACAACGCCAACGCCGGCGCGCGCAGCACTGCCGTCGACGACGGGGAGGAACAGGATCGTCTGCGGCAAG
GTGAGCAAGGGCAGCGCGGCGCCCAACTTCACG
CTGAGGGACCAGGACGGGAGGGCGGTGTCGCTGTCCAAGTTCAAGGGGAGGCCGGTGGTGGTGTACTTCTACCCCGCCGACGAGACCCCCGGATGCACCAAGCAGGCCTGCGCCTTCCGC
GACTCCTACGAGAAGTTCAAGAAGGCCGGCGCCGAGGTCATCGGCATCAGCGGCGACGACGCCGCCTCCCACAAG
GAGTTCAAGAAGAAGTACAAGCTGCCGTTCACGCTGCTGAGCGAC
GAGGGGAACAAGGTGAGGAAGGAGTGGGGTGTGCCGGCTGACCTGTTCGGGACGCTGCCGGGAAGGCAGACGTACGTGCTCGACAAGAACGGCGTCGTCCAGTACATCTACAACAACCAG
TTCCAGCCCGAGAAGCACATTGGCGAGACCCTCAAGATCCTCCAGAGCCTCTGA

Retrieve as FASTA