Entry information : Os2CysPrx
Entry ID 4022
Creation 2006-11-03 (Nicolas Rouhier)
Last sequence changes 2006-11-03 (Nicolas Rouhier)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-08-04 (Christophe Dunand)
Peroxidase information: Os2CysPrx
Name Os2CysPrx
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation Chloroplastic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Os2CysPrx
start..stop
S start..stop
Sb2CysPrx 452 1e-163 3..261 2..260
Zm2CysPrx02 451 4e-163 3..261 2..260
Zm2CysPrx01 441 2e-159 3..261 2..260
Ta2CysPrx 439 2e-158 5..261 3..258
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19901546..19901737 192 N° 2 19901825..19901899 75 N° 3 19902034..19902115 82 N° 4 19902219..19902298 80
N° 5 19903625..19903750 126 N° 6 19903872..19903985 114 N° 7 19904802..19904918 117  
join(19901546..19901737,19901825..19901899,19902034..19902115,19902219..19902298 ,19903625..19903750,19903872..19903985,19904802..19904918)


exon

Literature and cross-references Os2CysPrx
Literature Dietz et al The function of peroxiredoxins in plant organelle redox metabolism. J Exp Bot. 2006;57(8):1697-709.
Protein ref. UniProtKB:   Q6ER94
DNA ref. GenBank:   NC_008395.1 (19901546..19904915)
Cluster/Prediction ref. UniGene:   Os.12196
Protein sequence: Os2CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   261
PWM (Da):   %s   27966.29  
PI (pH):   %s   5.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAACCSSLATAVSSSSAKPLAGIPPAAPHSLSLPRAPAARPLRLSASSSRSARASSFVARAGGVDDAPLVGNKAPDFDAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYDEFEKLNTEILGVSIDSFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDEVCPAGWKPGDKSMKPDPKGSKEYFAAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 6 introns), cDNA and 143 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTGCTGCTCCTCCCTCGCCACCGCCGTCTCCTCCTCCTCCGCCAAGCCCCTCGCCGGCATCCCCCCCGCCGCGCCGCACTCCCTCTCCCTCCCCCGCGCTCCCGCCGCCAGG
CCCCTCCGCCTCTCCGCCTCCTCATCCAGATCCGCCCGGGCCAGCAGCTTCGTCGCCCGCGCCGGCGGTGTG
GTGAGCCCCGTCAATCTTTACCTGTATTTGATTGCTCTCCGTTGGTTC
GGTTCTCCTGCTTGCTTACTTCTGCTCTTGCCGTGTTAGGACGATGCGCCGCTGGTCGGGAACAAGGCGCCCGACTTCGATGCGGAGGCAGTCTTCGACCAGGAGTTCATCAACGTATGC
GTCTCATCGGCTCATATCTCACTTCTCAGATACAGAAAATTTCCTGGTAGCTGGTGGTTGTGTATGCTCCGAGCTCTGATTATTGCTCCTGTGGTTGGTTGGTTGCCACCGCTCCTCTGT
GATTGCAGGTGAAGCTGTCCGACTACATCGGGAAGAAGTACGTCATTCTCTTCTTCTACCCGTTGGACTTCACCTTCGTCTGCCCGACCGGTGAGCACGGAATGTTCGCGTTAAGGGCCC
CAATCGATGCTCATCGTGAGTGCCAGTGAAGTTTGCTCTGGTGCGCCGATTAATGCATTCCTGATGTTTGCAGAGATTACCGCTTTCAGTGACAGATACGATGAGTTCGAGAAGTTGAAC
ACTGAGATCCTCGGTGTTTCAATTGACAGTGTG
GTATGTTGTAGCGCCCTCGTACTCCATGCTTTCATCAATACTACCCAATGTCCCGTGCACTGCGATTGAGCTCAAATAAATTTTAAA
CTTGAATAGTTTTGTGTAATTCCTAGTAGAAACCATATATATTTTGCAAAAAAAATATCATCCACATACATAACATTATTAAAAGCCACATACGCAAATATCTACTCGTTGTTTAAAAGG
TCCCACCAACTCAAGAGGTGGTGGTAGCAAAATAACCGTGCATTGCAATGGATTTGAAAAAAAAGAATTACCATAAGTTGCAATCAAACATCAATCCACAAAAAGCCAAGCCACATTCAC
AAAACCTTAGAAGATCCTGCCAACTCAAGAGGTGGTTCTATGTGGAGTTCTTTTAGTTTTAGCATGCACTTGGCCATGCAAGTTTGATTAAGCTAGTACATAATAGTTCATAACATAAAT
TAGTGTCTCCCTCTCTCTATAGATAGATACATGTGGCTAGATCAATCGGTTGTATATAATATTCTGCAAATTCACATGCTATGTGACCTTTGGAGCATAACTACTGTCCTTATGAGTGCA
ATTTTAGCACTTCCAAGTTCTAAAAGAAATCTTTGGAAGCTTTGCATATTTGGATGCTGTTTTTTTTCGAGGAGAAATGGTTTACAGAACATAGTTGTGGGCTCAGTGTAGTCGCATGCA
ATTCTTTAGCTAAATTCACCATTTTCTGAATATCTTTTTCTAACTATTCTCGTATTGGGAGTGATGGTGTGACTAAAAATATGTGGACGATGGGATAGGGTCACACATGCTTTGTTCTTC
CCATTAAAATGCATGCCTGGTTAATGTATTGATTAACCGTAAAATCAATTTTATAGCAGCAGTTTGTCCCTAAGATCTTTCCTTTTGTATCTTATTATGACGCCTTAAGTGTTACAACAT
ACTTATTTATTCTAGATCACATGGTTGTCATGTTGTATGACCTACTTTGTTAGTGGAGCAGAGCATTTACGTCTTACTTTATTGCTTTGTACAGTTATGATATGTCAATCCCTTTGATAC
AAAAGACGTTCCACTTTTGTTCCATATTCATCACAATACAATTATGGGGGCATATTTATCATAAAAGGCATCTTTTAAATCTCATGCTAATACACTATAGTAAATATTATGGTCAAAGTG
ACACCTTGAAAACTACGGTAAGTAAGAATTGATTCCCCTCTTTCTGAATCAGAGGGAGTATTTGATTTATTTTCTGTAGTTCCATTATAGCAATAACCTTAGTGGTATTTTTCCATCATT
TTTGGTGATCTGACATGTGAAATAATTCTTTGGTTGTAGTTCTCCCATCTTGCATGGGTGCAGACAGACAGGAAATCTGGTGGGCTTGGTGATCTGAAATACCCATTGATTTCAGATGTT
ACTAAATCAATTTCGAAGTCCTTTGGTGTCTTGATCCCTGACCAG
GTATCCATATTCCATCCAACCATAGCATTCTTGCTTTAGATTCTTTGCTATCAACTGGTGCACTTTTCAGGATCT
GTTAGCTGCTTGTTATGTTTTCTAAATCTGAACGTTAATCTTTCAGGGAATTGCTCTGAGAGGACTTTTCATCATTGACAAGGAGGGAGTGATTCAGCACTCTACCATTAACAACCTTGC
CATTGGACGCAGTGTAGATGAGACCATGAGGACCCTTCAG
GTATGGCATTACATCAAATTGCTGCTTTTTGAGTAGGGCCTCTCTATGGGTCTATGGCCTCTAGGAAATAAAATAATAAA
TGACTAGTTGCTAATTTTGGAATTTTAGCCCAGAAACAGAGCACATTTGTTGAGCACCCGTAGTGCGTGATAAACACGTCATTTTGCAAAGATGGTTATCTTGAAGCACAACTCATGCAC
CATAAAATGGTTCTGGTGCGTTTTGATGTAGAGCAAAGTAGTGCTCTGTGTTTTAGAAACTTTATATGCACTTCGTTAGATTATGCAACCACCTTTCAACCAGTGAACTGAACACCTTTC
TTTGTACTTCTATTTGCTAAGATGAACGTCTACATTGTTCTACATGTAGGCATCGAGTCTAGAGTATACATTACTTTCTGCACATATTGTAAGAGTACTGTAGACCCATCAAGGACCCAC
AATATTTACCTGACGAACCTGAAGGAAAAAAAAACAAAGGCTCAGAAAAGTGCATCTAGGATCTGCTTAGGCTCATCCTGGGCATAGCTCAACATGAAGTTATCAGGCTGGCTTAATCGG
GCCAAGCTGTCAGGGCGACCTTGTGGTTTTTGGGGGGTGGAAGTTGCTAGGTGGGCCAAGCTGTCAGGGCGACCTTGTGGTTTTTGGGGGTGGAAGTTGCTAGGTGGGCGGTGGGCCAAT
CCTGGTCCATCCTGCATATAGGGGGGACCAGTTCATGTGTGTTTTCCAGTATGGGTTTCTTCAGTTAACCCGGTGGTTCACTGATCACAACTGTTAGCTGACATGACCACACATTTGCTG
TGCTTCTACTCTGCAGGCGTTGCAGTACGTCCAGGACAACCCGGACGAGGTGTGCCCGGCCGGATGGAAGCCCGGTGACAAGTCGATGAAGCCTGACCCCAAGGGAAGCAAGGAGTACTT
CGCGGCCATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTGCTGCTCCTCCCTCGCCACCGCCGTCTCCTCCTCCTCCGCCAAGCCCCTCGCCGGCATCCCCCCCGCCGCGCCGCACTCCCTCTCCCTCCCCCGCGCTCCCGCCGCCAGG
CCCCTCCGCCTCTCCGCCTCCTCATCCAGATCCGCCCGGGCCAGCAGCTTCGTCGCCCGCGCCGGCGGTGTG
GACGATGCGCCGCTGGTCGGGAACAAGGCGCCCGACTTCGATGCGGAG
GCAGTCTTCGACCAGGAGTTCATCAAC
GTGAAGCTGTCCGACTACATCGGGAAGAAGTACGTCATTCTCTTCTTCTACCCGTTGGACTTCACCTTCGTCTGCCCGACCGAGATTACCGCT
TTCAGTGACAGATACGATGAGTTCGAGAAGTTGAACACTGAGATCCTCGGTGTTTCAATTGACAGTGTG
TTCTCCCATCTTGCATGGGTGCAGACAGACAGGAAATCTGGTGGGCTTGGT
GATCTGAAATACCCATTGATTTCAGATGTTACTAAATCAATTTCGAAGTCCTTTGGTGTCTTGATCCCTGACCAG
GGAATTGCTCTGAGAGGACTTTTCATCATTGACAAGGAGGGAGTG
ATTCAGCACTCTACCATTAACAACCTTGCCATTGGACGCAGTGTAGATGAGACCATGAGGACCCTTCAG
GCGTTGCAGTACGTCCAGGACAACCCGGACGAGGTGTGCCCGGCCGGATGG
AAGCCCGGTGACAAGTCGATGAAGCCTGACCCCAAGGGAAGCAAGGAGTACTTCGCGGCCATCTAA

Retrieve as FASTA