Entry information : Os1CysPrx01 (RAB24)
Entry ID 4023
Creation 2006-11-03 (Nicolas Rouhier)
Last sequence changes 2006-11-03 (Nicolas Rouhier)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: Os1CysPrx01 (RAB24)
Name (synonym) Os1CysPrx01 (RAB24)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation Nucleus
Tissue types Callus
Flowers
Inflorescences
Mixed tissues
Seeds
Stems
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Os1CysPrx01
start..stop
S start..stop
Osi1CysPrx01 453 3e-165 1..220 1..220
Ta1CysPrx01-2B 394 8e-142 1..219 1..218
Ta1CysPrx01-2D 392 4e-141 1..219 1..218
Hv1CysPrx 392 5e-141 1..219 1..218
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26495351..26495468 118 N° 2 26495581..26495729 149 N° 3 26495829..26496224 396  
join(26495351..26495468,26495581..26495729,26495829..26496224)


exon

Literature and cross-references Os1CysPrx01 (RAB24)
Literature Gama et physiologia plantarum in press;
Dietz et al The function of peroxiredoxins in plant organelle redox metabolism. J Exp Bot. 2006;57(8):1697-709.
Yao Q., Peng R., Xiong A. Identification a novel antioxidant enzyme from rice.
Protein ref. UniProtKB:   P0C5C9 UniProtKB_Uniparc:   A3BMM5   Q0D4A2
DNA ref. GenBank:   NC_008400.1 (26495351..26496221)
Cluster/Prediction ref. UniGene:   Os.13972
Protein sequence: Os1CysPrx01 (RAB24)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220
PWM (Da):   %s   23970.21  
PI (pH):   %s   6.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTIGDTVPNLELDSTHGKIRIHDFVGDTYVILFSHPGDFTPVCTTELAAMAGYAKEFDKRGVKLLGISCDDVQSHKDWIKDIEAYPGNRVTYPIMADPSREAIKQLNMVDPDEKDSNGGHLPSRALHIVGPDKKVKLSFLYPACVGRNMDEVVRAVDALQTAAKHAVATPVNWKPGERVVIPPGVSDDEAKEKFPQGFDTADLPSGKGYLRFTKVG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 2 introns), 6 cDNA and 299 ESTs. Cultivarv="Japonica". Three other SwissProt/TREMBL accessions.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGGCTCACCATCGGCGACACCGTCCCCAACCTGGAGCTGGACTCCACCCACGGCAAGATCCGCATCCACGACTTCGTCGGCGACACCTATGTCATCCTCTTCTCCCACCCCGGT
ATACACACTACACACTACACTCGCTCGATTCTCACATTCTCATTCGGTAGTAGTTTGTGTGGATCGATGTGCATCCGATTGATTGATTGAATGATCCGTCGATCGATCAGGCGACTTCAC
CCCGGTCTGCACCACGGAGCTGGCAGCCATGGCCGGCTACGCCAAGGAGTTCGACAAGAGGGGCGTCAAGCTGCTCGGCATCTCCTGCGACGACGTGCAGTCTCACAAGGACTGGATCAA
GGACATCGAGGCCTACAAG
GTCATTTTAATTACCTTCCTGGCCTAGTTAAATTTGTGTGAAAACGTAGTAACTAATTAACTAGATCGATCGTAATAATATATATTTTTTTGGTTATAGCC
TGGGAACCGCGTGACGTACCCGATCATGGCCGATCCGAGCCGCGAGGCCATCAAGCAGCTGAACATGGTCGACCCGGACGAGAAGGATTCCAACGGCGGCCACCTCCCGTCCCGCGCGCT
GCACATCGTCGGCCCCGACAAGAAGGTGAAGCTGAGCTTCCTGTACCCGGCGTGCGTGGGGCGGAACATGGATGAGGTGGTGCGTGCGGTCGACGCGCTGCAGACGGCGGCGAAGCACGC
GGTGGCGACGCCGGTGAACTGGAAGCCCGGCGAGCGCGTCGTCATCCCTCCCGGCGTCTCCGACGACGAGGCGAAGGAGAAGTTCCCCCAGGGGTTCGACACCGCCGACCTGCCGTCCGG
CAAGGGCTACCTCCGCTTCACCAAGGTCGGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGGCTCACCATCGGCGACACCGTCCCCAACCTGGAGCTGGACTCCACCCACGGCAAGATCCGCATCCACGACTTCGTCGGCGACACCTATGTCATCCTCTTCTCCCACCCCGGC
GACTTCACCCCGGTCTGCACCACGGAGCTGGCAGCCATGGCCGGCTACGCCAAGGAGTTCGACAAGAGGGGCGTCAAGCTGCTCGGCATCTCCTGCGACGACGTGCAGTCTCACAAGGAC
TGGATCAAGGACATCGAGGCCTACAAG
CCTGGGAACCGCGTGACGTACCCGATCATGGCCGATCCGAGCCGCGAGGCCATCAAGCAGCTGAACATGGTCGACCCGGACGAGAAGGATTCC
AACGGCGGCCACCTCCCGTCCCGCGCGCTGCACATCGTCGGCCCCGACAAGAAGGTGAAGCTGAGCTTCCTGTACCCGGCGTGCGTGGGGCGGAACATGGATGAGGTGGTGCGTGCGGTC
GACGCGCTGCAGACGGCGGCGAAGCACGCGGTGGCGACGCCGGTGAACTGGAAGCCCGGCGAGCGCGTCGTCATCCCTCCCGGCGTCTCCGACGACGAGGCGAAGGAGAAGTTCCCCCAG
GGGTTCGACACCGCCGACCTGCCGTCCGGCAAGGGCTACCTCCGCTTCACCAAGGTCGGCTAG

Retrieve as FASTA