Entry information : PtPrxII06 (POPTR_0019s04070 / PtPrxIIF)
Entry ID 4025
Creation 2006-10-30 (Nicolas Rouhier)
Last sequence changes 2006-10-30 (Nicolas Rouhier)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrxII06 (POPTR_0019s04070 / PtPrxIIF)
Name (synonym) PtPrxII06 (POPTR_0019s04070 / PtPrxIIF)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII002]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Mitochondria
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrxII06
start..stop
S start..stop
LuPrxII119 327 4e-115 1..203 55..255
NtPrxII06a 324 4e-115 1..203 1..193
NtPrxII06b 323 1e-114 1..203 1..193
CsPrxII05 323 2e-114 1..203 3..203
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4152802..4153023 222 N° 2 4153119..4153148 30 N° 3 4154362..4154520 159 N° 4 4154988..4155082 95
N° 5 4155339..4155444 106  
join(4152802..4153023,4153119..4153148,4154362..4154520,4154988..4155082,4155339 ..4155444)


exon

Literature and cross-references PtPrxII06 (POPTR_0019s04070 / PtPrxIIF)
Literature Gama et physiologia plantarum in press.
DNA ref. Phytozome 11:   scaffold_19 (4152802..4155444)
Protein sequence: PtPrxII06 (POPTR_0019s04070 / PtPrxIIF)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   203
PWM (Da):   %s   21797.23  
PI (pH):   %s   8.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAILKRTSPSCLLKSMADSLGIIGGSWRSYAKVAVGTDIVSAAPGVSLQKSRTWDEGVSSKFSTTPLKDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKNIIDKFKAKGIDSVICVAVNDPYTMNAWAEKLQAKDAIEFYGDFDGSLHKSLELNKDLSVALLGHRSERWSAYVEDGMVKVLNVEEAPSDFKVSSGEVILGQI

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTGCAATCCTCAAGCGAACAAGCCCTTCTTGCCTCCTCAAGTCAATGGCTGATAGTCTCGGAATCATCGGAGGATCGTGGAGATCCTACGCTAAGGTTGCAGTCGGGACTGAC
ATAGTCTCCGCTGCACCCGGCGTTTCCCTCCAAAAATCCCGGACCTGGGACGAAGGTGTTTCTTCAAAATTCTCAACAACTCCATTAAAAGACATTTTCAAG
GTTGGCTAGTTAATTGAG
AAATTAAATACGTAAAATACCAATTTTTTAATGTTTTAATTAATTGTGATTTGTTTTCTTTAATTTCATATTTTCAGGGCAAAAAAGTTGTCATCTTCGGCCTCCCTGTAAGTATCTTCT
GCATTTTAATTCATGTTTTCCTGCTTCTTTTATTACATATTTGGTGGAATTGAATTTTGTTTTTTGGGTATAATTTTAATTGATTTTTGGCAATTAGGTCTCCTTTTTTTCTTTTTTTTG
GCTATTGATAGGACCCTACAGCCCACAATCAGTGGTTAAGCAGTCTAGGGATAAAAGATGAAGGTTTAATCTGGCATTCTCTTGTAATGGGGCATATTTTAAGCTCAAATACTCTAGACA
GGATTCGAATCTGTGACCTCCTTGCAAGTACAAGGAGCTCACTACCATTAGGCCAGACGCCTAGTGGTGTTGTGATTAAATATTTAAAATTTCTTGAACTTTGCAAGTGACTGACATAAA
AAAAGGAGACAATTATTGCTCGGTTGCAGTTAGTGATTCAAGGTTAGTATAATGTTTAGTGGCTGCATTTGTGCTATCCATGACGTTAAATTAACAAGGTTATTCGGAAAATTCATCCTT
ATCTCCTGTTATGCATAGATTATTTCATTAGTGATGCTCATGAGTGTTGTAATTGGTCTCTACATGACATTGTATATCAAAATGAGTGCTATTATATTCTTACTCTTTTTGTTTCTTCTC
CGTTGTCTCTATTGGAGCAAGTAAAGCCCATGCAAGCACAAAATCAAATGCAATCCACAATATAGTTAATTTGTGAAGTTCTTTATATATATATAAGCCAAGAGAAATCTGGATTGTACC
AGACAAATAGGTGAAACAAACCTCACTTGTAAGGGTCCTTTTCTCCTATTATCCACTTAAAAACCTGGTTTCTAATCAGGAAAAAATTATAAATAGCTTCAAGTAGATGTCAAGCTTGTG
AAATTAATCATTAAGTTAACCTCATGCTATGCATCACAAACAAATCAATGAACAGCACTAAAGACAATTAATCCTCTTATTGCACTTTTCCTTTTGGTATGATAGACATGAAGTTGGAAG
CCGAAATGATTGTTGTTTCAATGCAAACACTGGTGTGGATGACAATGGGGAAGAGGAGAAGAGGGTGGTTTTTTATTGAAGAAAGTGTGGAAGCGATATTAATTTGTTTTGGGAATAAGA
TTCTCAAGACAAAGATTTGATAAAGAATGACCTAAATAGCTAAAACATGATTCTTTTTATTTTGTGACTTAATTTTGTTGATAGAAAACTATTTTTATGTGTTGCGTTTACCATGTCCAG

GGAGCATACACAGGGGTTTGTTCACAGCAGCATGTGCCTAGTTACAAAAATATAATTGATAAGTTCAAGGCTAAAGGGATTGATTCTGTCATTTGTGTGGCTGTTAACGATCCATATACT
ATGAATGCTTGGGCAGAGAAACTTCAAGCTAAAGATGCT
GTAAGTGATTATTGTGAATCATATACATTTGTGTCTCTTTTCTTACATGTGATCTGAAAACCTTTTCTATTTGTTTTGATT
TTGCTTGTCTCCTTTTTTGTAATGTCTCAATTTCCAGTTAAACTTTATGGTTGAATCTTTACAGTTTTCTATATTCTAGGAAATTTCCTAGAAAACTAGATAATTCTCCAAAGTAGACAT
GACGTTAATGGCTTTATTCCCTAATTGTGCAATTATGTGACATCACTAAACCATGTACTGTTTGCTGCTTCATAAGATGTCTGCAAGTGGAGTTAATTTTCCGGCCTTTTAATCCCATGA
ATCATCGGTGCTGTTATTATTTCCATACTGTAGAAGTTTTATCCTCTTTGCAGGAACAATGTCATCTTGTTAGGGTAGTTAACTGTTCCAATATGCAGTATCTTCTTCACTTTATTTCCC
TTTTAACTAGCCTTTTTCTATTTTAGATTGAATTTTATGGAGACTTTGATGGGAGCCTTCACAAGAGCTTGGAATTAAATAAAGATCTCTCTGTTGCTTTGCTAGGGCATCGCTCTGAAA
G
GTATGATGCTGTCATGTCTGTTCTTGGTGTTCTAACATGCGTGTGTTTCCCAGCATTCTGAATTATCTGATCTAGGGATCTCATTTGATTTCCCTGTTTTTCTTTTTGCTGAGTGCTCT
TTGGGCCAATTAACCCTAAAATGCAATTCGTAGTTTATATTGGTTATTTACTTTCATCCACCCAAGACTCTACTGATCTGTGTGTTGATCATGGATATATTTTCCTTAGACATTTGACTC
TTGTGTACTTTGTGTAGATGGTCTGCTTATGTGGAAGATGGAATGGTGAAGGTTCTAAATGTAGAGGAAGCTCCATCCGACTTCAAGGTTTCCAGCGGCGAAGTCATACTGGGACAAATC
TAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTGCAATCCTCAAGCGAACAAGCCCTTCTTGCCTCCTCAAGTCAATGGCTGATAGTCTCGGAATCATCGGAGGATCGTGGAGATCCTACGCTAAGGTTGCAGTCGGGACTGAC
ATAGTCTCCGCTGCACCCGGCGTTTCCCTCCAAAAATCCCGGACCTGGGACGAAGGTGTTTCTTCAAAATTCTCAACAACTCCATTAAAAGACATTTTCAAG
GGCAAAAAAGTTGTCATC
TTCGGCCTCCCT
GGAGCATACACAGGGGTTTGTTCACAGCAGCATGTGCCTAGTTACAAAAATATAATTGATAAGTTCAAGGCTAAAGGGATTGATTCTGTCATTTGTGTGGCTGTTAAC
GATCCATATACTATGAATGCTTGGGCAGAGAAACTTCAAGCTAAAGATGCT
ATTGAATTTTATGGAGACTTTGATGGGAGCCTTCACAAGAGCTTGGAATTAAATAAAGATCTCTCTGTT
GCTTTGCTAGGGCATCGCTCTGAAAG
ATGGTCTGCTTATGTGGAAGATGGAATGGTGAAGGTTCTAAATGTAGAGGAAGCTCCATCCGACTTCAAGGTTTCCAGCGGCGAAGTCATACTG
GGACAAATCTAA

Retrieve as FASTA