Entry information : PtPrxII03 (POPTR_0018s09030 / PtPrxIIC)
Entry ID 4028
Creation 2006-10-30 (Nicolas Rouhier)
Last sequence changes 2006-10-30 (Nicolas Rouhier)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrxII03 (POPTR_0018s09030 / PtPrxIIC)
Name (synonym) PtPrxII03 (POPTR_0018s09030 / PtPrxIIC)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Cytosolic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrxII03
start..stop
S start..stop
PbPrxII03 328 6e-118 1..162 1..162
PtrtrPrxII02 319 2e-114 1..162 1..162
PtPrxIIC-2 319 2e-114 1..162 1..162
PtremPrxII03 311 3e-111 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9906516..9906670 155 N° 2 9906361..9906440 80 N° 3 9905615..9905868 254  
complement(join(9905615..9905868,9906361..9906440,9906516..9906670))


exon

Literature and cross-references PtPrxII03 (POPTR_0018s09030 / PtPrxIIC)
Literature Gama et physiologia plantarum in press.
DNA ref. Phytozome 11:   scaffold_18 (9906670..9905615)
Cluster/Prediction ref. UniGene:   Pth.12141
Protein sequence: PtPrxII03 (POPTR_0018s09030 / PtPrxIIC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17292.04  
PI (pH):   %s   6.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDVLPDGKLAYFDEQDQLQEVSVHSLVAGKKVILFGVPGAFTPTCSLKHVPGFIEKAGELKSKGVTEILCIVNDPFVMKAWAKSYPENKHVKFLADGSATYTHALGLELDLQEKGLGTRSRRFALLVDDLKVKAANIEGGGEFTVSSADDILKDL

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 39 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCGATCGCTGTTGGTGATGTCTTGCCTGATGGAAAGCTCGCTTATTTCGACGAGCAAGATCAGCTCCAGGAAGTGTCCGTACACTCTCTAGTTGCCGGTAAAAAGGTCATCCTC
TTTGGTGTTCCCGGTGCCTTCACCCCCACCTGCAG
GTAAACAGAGTTATTATTTTTATGGTTCCGATTTAAGTATATACATGATTCATTTTGTTGTTTGGTGATTTGTAGCTTGAAGCAT
GTGCCGGGGTTTATCGAGAAAGCAGGGGAGTTAAAATCAAAGGGCGTTACTGAAATTTTGTGCATCAGCG
GTACGTCGTCATTTCCATTTGGGGATCTATTTTTTTAATTAATTTGATTT
TCTTATTTTTGCGTCATTTTGATTAAAAATCTGTACAGCAACTAGGGTTTCACCATTTGTTGCGAATTAATGTAATCTGGGTTAAGTTTTTGTATCTAAGTTGACCAGTTGTTCTAATTG
AAATTGGAAGGAAGAGCAAAGCTGCTCGAAATGCTGGTTCTGTTTTTTTCTAATTTGGGAATCTGTCCGAAACACCTAATCTGCTACTGGTATTCGTGTTGGAGGAAAAACTAAAATGTG
TGCGGCCTTACTTCAACTCGCATTGTTCTTAAGTCTGCATCTCTTGTTTTGGTTGGCGTAAATAATATGTATGTAACTTATCAGCTGGATCTGTTATATTCTGTTGGAATTCAGACTAAT
TACAGGTTTAGAAAACTAAAAGAATAAAAGAAAGTGATTGGTTTCCGTGTTTTTTGAGTTTTGGTTTCTTATTCATTTGTAGTCAACGACCCCTTTGTGATGAAGGCATGGGCCAAATCT
TACCCTGAGAATAAGCATGTCAAATTCTTAGCTGATGGGTCTGCAACGTACACCCATGCTCTCGGCCTTGAGCTTGACCTGCAAGAGAAAGGGCTTGGCACACGTTCTAGGAGGTTTGCT
CTCTTGGTTGATGACCTTAAGGTGAAAGCTGCAAATATTGAAGGGGGTGGAGAATTCACTGTGTCCAGTGCCGATGATATCCTCAAGGATCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCGATCGCTGTTGGTGATGTCTTGCCTGATGGAAAGCTCGCTTATTTCGACGAGCAAGATCAGCTCCAGGAAGTGTCCGTACACTCTCTAGTTGCCGGTAAAAAGGTCATCCTC
TTTGGTGTTCCCGGTGCCTTCACCCCCACCTGCAG
CTTGAAGCATGTGCCGGGGTTTATCGAGAAAGCAGGGGAGTTAAAATCAAAGGGCGTTACTGAAATTTTGTGCATCAGCGTCAAC
GACCCCTTTGTGATGAAGGCATGGGCCAAATCTTACCCTGAGAATAAGCATGTCAAATTCTTAGCTGATGGGTCTGCAACGTACACCCATGCTCTCGGCCTTGAGCTTGACCTGCAAGAG
AAAGGGCTTGGCACACGTTCTAGGAGGTTTGCTCTCTTGGTTGATGACCTTAAGGTGAAAGCTGCAAATATTGAAGGGGGTGGAGAATTCACTGTGTCCAGTGCCGATGATATCCTCAAG
GATCTTTGA

Retrieve as FASTA