Entry information : Pt2CysPrx01 (POPTR_0016s07280 / Pt2CysPrxA)
Entry ID 4031
Creation 2006-11-03 (Nicolas Rouhier)
Last sequence changes 2010-07-08 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: Pt2CysPrx01 (POPTR_0016s07280 / Pt2CysPrxA)
Name (synonym) Pt2CysPrx01 (POPTR_0016s07280 / Pt2CysPrxA)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Chloroplastic
Tissue types Buds
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pt2CysPrx01
start..stop
S start..stop
Pt2CysPrx02 488 8e-178 1..269 1..263
Vv2CysPrx01 437 2e-157 1..269 1..273
Cs2CysPrx 432 2e-155 32..269 33..271
Ptrem2CysPrx01 425 3e-153 44..269 1..226
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5176081..5176296 216 N° 2 5175878..5175952 75 N° 3 5175472..5175553 82 N° 4 5175297..5175376 80
N° 5 5174404..5174529 126 N° 6 5173882..5173995 114 N° 7 5173624..5173740 117  
complement(join(5173624..5173740,5173882..5173995,5174404..5174529,5175297..5175 376,5175472..5175553,5175878..5175952,5176081..5176296))


exon

Literature and cross-references Pt2CysPrx01 (POPTR_0016s07280 / Pt2CysPrxA)
Literature Gama et physiologia plantarum in press.
DNA ref. Phytozome 11:   scaffold_16 (5176296..5173624)
Cluster/Prediction ref. UniGene:   Pth.1112
Protein sequence: Pt2CysPrx01 (POPTR_0016s07280 / Pt2CysPrxA)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   269
PWM (Da):   %s   29390.11  
PI (pH):   %s   6.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSATSTTLISSIAAAATATTTKSMAFPISKNITLPNSFFGTRKSFQSRAPRSISLTRGSHSRSTFVVKASSELPLVGNIAPDFEAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEQINTEVLGVSIDSFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSYGVLIPDQGVALRGLFIIDKEGVIQHSTINNLAIGRSVDETKRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKDYFAAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns), and 26 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCAGCTACCTCCACCACTCTCATCTCCTCTATCGCCGCCGCCGCCACCGCCACCACCACCAAATCCATGGCCTTTCCTATCTCTAAAAACATAACTCTCCCCAACTCATTT
TTTGGCACTCGCAAATCCTTCCAATCTCGCGCCCCTCGTTCCATTTCCTTGACTCGTGGCTCTCATTCTAGAAGCACCTTCGTTGTCAAAGCCTCT
GTAAGTTTTTTCTCAGACTCGTTG
GTTTTTATGACCCAAATTCCCATTTCATTAACTATTTGAAAGAGCTTTTCTTCTGTGTTTGATTCAGCCTCTAACTAAGTTTGCTTTCGTTTTCTTCTGTGCAGAGCGAACTTCCATTGG
TCGGAAACATAGCACCGGATTTCGAGGCGGAGGCTGTCTTCGATCAAGAGTTCATTAAT
GTACTTTGTGCTGACAATGTTATCGAATATAAGGAGTTCATGTCATGTCATTCTTTTTTTT
AATTAAATTAAATTTTAATTTACATTGAAGGAATTGTATGATTACAATGTTTCTATTTTGCACAGAAATTTGGTCTTAAAAAATAGATTAAGTACCTAATTGCTACTCTGATTGTTGTAA
AATCGTAAAATTTGAAAGCCAGTTAATTGTTAGCTTGATTGGCTATGAAAATTGTGTGGTGAATTGAGCTTGCATTTGTGCTCCTGTGTTGTGTATTATTCTTTCAAACTCTTTTATGTT
TTATTGGTTAATTTTGGTTTCAGGTTAAACTGTCTGATTATATTGGGAAGAAATATGTGATTCTATTTTTCTATCCATTGGACTTCACATTTGTTTGTCCCACAGGTTTGTTTGGAACTT
AGCTTATGTCGTTTGAAGCTTTGACGAGTTGTGGATGCTAATTGTTCTTCTCATATTTTTTCTGTTTCACTTGTGTGCAGAAATCACTGCTTTTAGTGACCGTCATGAGGAATTTGAGCA
GATAAACACAGAAGTGTTGGGTGTTTCAATCGACAGTGTG
GTATATATCTTCTTTTGTCAAAATCAAGAAAGAAAATTCTAGGAATCCTGTGACTTCGGCCTGAAATCTTAGTGGATCTT
ATGTTTTCACTTCAAGTTTTCAACTTTTATTTGATGAGTTGGAGCACATACTCCCGCAGACAACACACACGTTTAGGATTATATAATATGTCTCTAGATAGTCTAATTGAATTTTTTTGT
TTCAGTGGGGTGGGGGGGAAGGATTCTTGTAGCCAACCTAAAGTAGCTGGATTATAGCTTGGGTTGACTTGACTTTGACTTGAATTTGTGTGTATTATTCATATCGGTTTCCTTTATATA
AATAATGTGAGCCATGCTTGCTAGCACAATTGATAAAATTGCGTGGCCTTTGCATGTATTTTGAAAACGTATGGTTCAAATCACAGCATTCTGAGTTGATAAGTTGAAGTGAATATTGTA
ATGGACAAAAAGTAACTTGGCTGTAGAAGAAACTAGGAACTGAAAATTACTGTAAAGAATCTCAATTTGGTTTTCGTTATAAATCCATTGACTTTAGCTATAGAAGCTATCGTCTGCATA
TAATGCAATTGCAACCTTGTTGGTTGCAAGTTTGGTCATTGCCAATTTTCATTAGCTTTTGTCTGTACTGATAAAATACATAAACATTTGCTTTCAAAATTGGAACCATCCACTATCTGT
TTGTTGTATCAGAGCTGATTTTGGTATTGGACTAAAAATCATAAATTGATTATTGGTGTTGAGCGTGTCATGATATTCTCTGTGTAGTTCTCGCACCTTGCCTGGGTCCAAACGGATAGA
AAGTCTGGTGGGCTTGGAGATTTGAAGTATCCTTTGATTTCTGATGTCACCAAATCCATTTCAAAATCTTATGGAGTGCTAATTCCTGATCAG
GTACGAGATGTTTTTATTAATGTTGTT
CTAAGAAACACAATGAACTCATTAAAAACCTTCATTTTTTTAATAACACTTTGTTATTGCATAACCGTGTACATGTACAAATGCACATCCATGCATTTTTTTGTCTGTTGTTTGTTACTG
GCAAGACTCAGTATCAAGCTAAACCATAATGACTTAGGTCTAGCTCACATCTAGTTCTCTATTGAATGGGAATCAGAGTGCCGTGTTATTCTCTTAGTGGCCTTATCTATCCTGTGGTTA
ATGCCACTCCCATTGTCAGACAATGCTGAGAAAAGGGCTCTCTCGTATTAATCACCACTGCCCGTTAACCTCTGCACAGTGCTTGGAAGAGGAGCCTCTGCCTCCGCGTTTTCTTTTTTT
GATACTTGGTTTTAATTTCAGGGAGTTGCTCTGAGAGGACTTTTCATCATTGATAAAGAAGGAGTCATCCAACATTCCACCATTAACAACCTTGCCATTGGGCGTAGTGTTGACGAGACG
AAGAGGACACTCCAG
GTGATTTCACAAATACAGGGAAAAGATATTCTAAAACTGGAAGATTTTGTAAATTAAGGATTGGCATGATTGTACACCTGAAGTGCCTTTCGGCATATGTTTTCC
ATTCATTCTTATTGATTGCTTTTGCATTTATTACAGGCCTTGCAGTATGTGCAAGAAAATCCAGATGAAGTTTGCCCAGCTGGGTGGAAGCCTGGTGAGAAGTCCATGAAGCCTGATCCA
AAGCTGAGCAAGGATTACTTTGCTGCCATATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCAGCTACCTCCACCACTCTCATCTCCTCTATCGCCGCCGCCGCCACCGCCACCACCACCAAATCCATGGCCTTTCCTATCTCTAAAAACATAACTCTCCCCAACTCATTT
TTTGGCACTCGCAAATCCTTCCAATCTCGCGCCCCTCGTTCCATTTCCTTGACTCGTGGCTCTCATTCTAGAAGCACCTTCGTTGTCAAAGCCTCT
AGCGAACTTCCATTGGTCGGAAAC
ATAGCACCGGATTTCGAGGCGGAGGCTGTCTTCGATCAAGAGTTCATTAAT
GTTAAACTGTCTGATTATATTGGGAAGAAATATGTGATTCTATTTTTCTATCCATTGGACTTCACATTT
GTTTGTCCCACAG
AAATCACTGCTTTTAGTGACCGTCATGAGGAATTTGAGCAGATAAACACAGAAGTGTTGGGTGTTTCAATCGACAGTGTGTTCTCGCACCTTGCCTGGGTCCAAACG
GATAGAAAGTCTGGTGGGCTTGGAGATTTGAAGTATCCTTTGATTTCTGATGTCACCAAATCCATTTCAAAATCTTATGGAGTGCTAATTCCTGATCAG
GGAGTTGCTCTGAGAGGACTT
TTCATCATTGATAAAGAAGGAGTCATCCAACATTCCACCATTAACAACCTTGCCATTGGGCGTAGTGTTGACGAGACGAAGAGGACACTCCAG
GCCTTGCAGTATGTGCAAGAAAATCCA
GATGAAGTTTGCCCAGCTGGGTGGAAGCCTGGTGAGAAGTCCATGAAGCCTGATCCAAAGCTGAGCAAGGATTACTTTGCTGCCATATAG

Retrieve as FASTA