Entry information : Pt2CysPrx02 (POPTR_0006s22130 / Pt2CysPrxB)
Entry ID 4032
Creation 2006-11-03 (Nicolas Rouhier)
Last sequence changes 2010-07-08 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: Pt2CysPrx02 (POPTR_0006s22130 / Pt2CysPrxB)
Name (synonym) Pt2CysPrx02 (POPTR_0006s22130 / Pt2CysPrxB)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Chloroplastic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pt2CysPrx02
start..stop
S start..stop
Pt2CysPrx01 482 3e-175 1..263 1..269
Ptrem2CysPrx01 446 8e-162 38..263 1..226
Vv2CysPrx01 434 2e-156 1..263 1..273
Nt2CysPrx02-1A 425 8e-153 1..263 1..267
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21195679..21195876 198 N° 2 21195456..21195530 75 N° 3 21195019..21195100 82 N° 4 21194843..21194922 80
N° 5 21193879..21194004 126 N° 6 21193189..21193302 114 N° 7 21192908..21193024 117  
complement(join(21192908..21193024,21193189..21193302,21193879..21194004,2119484 3..21194922,21195019..21195100,21195456..21195530,21195679..21195876))


exon

Literature and cross-references Pt2CysPrx02 (POPTR_0006s22130 / Pt2CysPrxB)
Literature Gama et physiologia plantarum in press.
DNA ref. Phytozome 11:   scaffold_6 (21195876..21192908)
Protein sequence: Pt2CysPrx02 (POPTR_0006s22130 / Pt2CysPrxB)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   263
PWM (Da):   %s   28677.81  
PI (pH):   %s   8.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSATSTSFISSIAAAKSMATPLSKTLTLPNSFSGTRKSIQSPVLRSISLTRGSHSAKSFVVKASSELPLVGNVAPDFEAEAVFDQEFIKVKLSEYIGKKYVVLFFYPLDFTFVCPTEITAFSDRYEEFKQINTEVLGVSVDSFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSYGVLIPDQGVALRGLFIIDKEGVIQHSTINNLAIGRSVDETKRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPRQSKDYFAAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and 7 ESTs (DT495540, DT479533, DT484010, DT480697, DT478918, DT497101, DT490852). Found mixed in the Unigen Pth.15098 (Pt2CysPrxA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCGGCAACTTCTACCTCTTTCATCTCCTCTATCGCCGCCGCCAAATCCATGGCCACTCCTCTCTCTAAAACCCTAACTCTCCCCAACTCCTTCTCTGGTACACGGAAATCT
ATCCAATCTCCCGTCCTCCGTTCCATTTCCCTGACCCGCGGCTCTCATTCTGCAAAGTCCTTCGTTGTCAAAGCCTCT
GTAAGTTCAAACATAAATAAATAATTCAGATTGGATCGATGA
TTTTTATGCCTTCAATTTGCGTTTCTATAGTAATTCTTTGTAAATGCTTCTCTTGTGTTTGATAATTAGTCTCTAACTAGGTTTGCTTTCGTTTTCATCTGTGTAGAGTGAACTTCCATT
GGTTGGAAACGTAGCACCGGATTTCGAGGCTGAGGCTGTTTTCGATCAAGAGTTTATTAAG
GTAGTTTGTGCTTACAATGCTGTTGAATATAAGGAGTTATTTTCATTCCTTTTTTAACC
GACTTTTTTAATTAAATTTCTTAATGTACATTGAAGTATTGTTTGGTGAAATTTGGACTTGAAAAAACAGTTAATTGCTGCTTTGATCGTTGTAAAATCTTAACTGGTTAATTGTTAACT
TGATTAACGATGATAATGTGTCAATCAAGCTAGTTGAGATATGTTTTATTCAGGTTTCTTTGTGAAAATTGTATTCTTTTAATGAATGTGAATTGATTTTGTTACCACCTTGCAATTGCG
GTCATGTTTTGTTGTTTATTTTAAACTCTAGTTTGATTTGGTAATTTTGGTTTCAGGTTAAACTATCTGAATATATCGGGAAGAAATACGTGGTTCTATTTTTCTATCCATTGGACTTCA
CATTTGTTTGTCCCACAG
GTTTGTTTTGAACTCAGCAAATGTAATTTGAAGTTTCAATGAGTTGTGGATGCTAATTGTTCTTCAAATTTTTTTTTTTGACCCACTTGTGTGCAGAAATCA
CTGCTTTTAGTGACCGTTATGAGGAATTCAAGCAGATAAACACAGAAGTATTGGGTGTTTCAGTTGACAGTGTG
GTATGTTCTTTTGTTTTTTGAAAATCAAGAAACAAAATCCTAGGAG
TTGTATGACTCCGGCCTGAAACTTTGGTGGTTTTTAAGTCTTCACTTGAAGTTTTCAACTTTATTTGATGATCTGGCTCTCACACAACACACGCATTTAGATAATGTCTCTAGATAATCT
CATTGGAAACTTTTGTTTCTGTGAGGTGGGGGGAAGGATTCTTGTAGCCAACCTAAGCTTGCTTGGATTAAAGCTTGGTTGCGGTGATTTTGCATGTATGTATATATGTATTAGTTTCCT
TAACAGAAATAATGCGGGCCTTGCTTGCTAGAACAACTGAGAAAATTGCATGGCCTTTGCGTGTATTTTGAAACTGTATGACTCAAATCACAGCATTCTGTGTTGCTCAGCTGAAGTGAA
TATTGTGATGGACAAAACTTGGACTTGGTTGAAGAAGAAAATAGGAACTGATAATTAGTGTAAAGAATCTCAATTTTGGTTCCTGTCATAAATCTATTGAATTTGGCTGTAGAAGTTATA
ATCTTCATATAATGCAATTGCAACCTTTTTGGTAGCAAGTTAGGTCATTACTGCTCAGTGGCTACTATTCCATAAGCTTTTGTCTGTTCTAGTAATACATAAACATTTGCGTTAATAACT
GGAATTGTTTATTGATATTGATTACAGCTGATTTTCTGGACAAAATTAGCTTCTAAGTTTGTTTATTGATATTGATCACAGCGAATGGAAGTATCCACTATCCATTTGCTGTATCACAGC
TGATTTTGGTCTTGGACTAAAAATCAGAAATTGTTTATTGATATTGATTATGTCATGATACTCTTTGTGCAGTTCTCGCACCTTGCCTGGGTCCAAACAGATAGAAAGTCTGGTGGGCTT
GGAGATTTGAAGTATCCTTTGATTTCTGATGTCACCAAATCCATTTCAAAATCTTATGGAGTGTTAATCCCTGATCAG
GTATGAGGAGCTCTTTTTTTTTTTTTTATTGTCATTCTAAAA
GAACACAATAATCCCCTTCGATTCTTTTAATGTGTGTACATGCACACATCCATGCATTAGTTGTCTTCTATTTATTACTGGCATGAATCAGTATGAAGCTAAACTATTGTGACTTAGGTC
TAATGCACATTTAGTTCTCTATTGAACGGGAATCAGACTGTCTTGTTCATTCTCTTAGTGGTCCTATGGATCCTGAAGTTAATGCAGTGCGTAACTACATGCATGTACATGCACACATCC
ATGCATTAGTTGTCTTCTGTTTATTACTGGCACGATTCAGTACGAAGCTAAACTATTGTGACATAGGTCTCATGCACATTTAGTTCTCTAATGAATATTGAATGGGAATCAGACTGTCTT
GTTCATTCTCGTAGTGGTCCTATGGATCCTGAAGTCAATGCCCATTGTCTGATAATGTTGGGAAAAGGGTTCTCATATTAAACACCATGGCCACTCAGCCTCTGCACGCCGCTTGGAGGA
GGAGCCCTGGCCTCTGCATTCCTTTTATTTATTTAGTTATGGTTTTAATTTCAGGGAGTTGCTCTGAGAGGACTTTTTATCATTGATAAAGAAGGAGTCATCCAACACTCCACCATTAAC
AACCTTGCCATTGGGCGTAGTGTTGACGAGACAAAGAGAACACTCCAG
GTGATTTCACAAATACAGGGCAACAATATTCTAAAATCAGAAGATTTTGTAAATTAAGACTTGGTTTTATTG
TAGATCTAAAGTGCCTTTGGGCATGCATATGTTCTCCTTCCATTCTGATTGATTTCTGTTTAATCGTTTTTTGCTTTTGCATTTTCGTGCAGGCCTTGCAGTATGTGCAAGAAAATCCAG
ATGAAGTTTGCCCAGCTGGGTGGAAGCCTGGTGACAAGTCCATGAAACCTGACCCAAGACAGAGCAAGGATTACTTTGCCGCATTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCGGCAACTTCTACCTCTTTCATCTCCTCTATCGCCGCCGCCAAATCCATGGCCACTCCTCTCTCTAAAACCCTAACTCTCCCCAACTCCTTCTCTGGTACACGGAAATCT
ATCCAATCTCCCGTCCTCCGTTCCATTTCCCTGACCCGCGGCTCTCATTCTGCAAAGTCCTTCGTTGTCAAAGCCTCT
AGTGAACTTCCATTGGTTGGAAACGTAGCACCGGATTTCGAG
GCTGAGGCTGTTTTCGATCAAGAGTTTATTAAG
GTTAAACTATCTGAATATATCGGGAAGAAATACGTGGTTCTATTTTTCTATCCATTGGACTTCACATTTGTTTGTCCCACAGAAATC
ACTGCTTTTAGTGACCGTTATGAGGAATTCAAGCAGATAAACACAGAAGTATTGGGTGTTTCAGTTGACAGTGTG
TTCTCGCACCTTGCCTGGGTCCAAACAGATAGAAAGTCTGGTGGG
CTTGGAGATTTGAAGTATCCTTTGATTTCTGATGTCACCAAATCCATTTCAAAATCTTATGGAGTGTTAATCCCTGATCAG
GGAGTTGCTCTGAGAGGACTTTTTATCATTGATAAAGAA
GGAGTCATCCAACACTCCACCATTAACAACCTTGCCATTGGGCGTAGTGTTGACGAGACAAAGAGAACACTCCAG
GCCTTGCAGTATGTGCAAGAAAATCCAGATGAAGTTTGCCCAGCT
GGGTGGAAGCCTGGTGACAAGTCCATGAAACCTGACCCAAGACAGAGCAAGGATTACTTTGCCGCATTGTAG

Retrieve as FASTA