Entry information : Pt1CysPrx (POPTR_0008s09930 / Potri.008G099900)
Entry ID 4033
Creation 2006-11-03 (Nicolas Rouhier)
Last sequence changes 2010-07-08 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: Pt1CysPrx (POPTR_0008s09930 / Potri.008G099900)
Name (synonym) Pt1CysPrx (POPTR_0008s09930 / Potri.008G099900)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Nucleus
Tissue type Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pt1CysPrx
start..stop
S start..stop
Ptre1CysPrx 453 2e-165 1..220 1..220
Lu1CysPrx219 375 2e-134 1..219 1..220
Vv1CysPrx 373 1e-133 1..218 1..219
Lu1CysPrx93 372 2e-133 1..219 1..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6152276..6152390 115 N° 2 6152044..6152192 149 N° 3 6151702..6151848 147 N° 4 6151244..6151495 252
complement(join(6151244..6151495,6151702..6151848,6152044..6152192,6152276..6152 390))


exon

Literature and cross-references Pt1CysPrx (POPTR_0008s09930 / Potri.008G099900)
Literature Gama et physiologia plantarum in press.
DNA ref. Phytozome 11:   scaffold_8 (6152390..6151244)
Omic ref. ePlant:   Potri.008G099900
Protein sequence: Pt1CysPrx (POPTR_0008s09930 / Potri.008G099900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220
PWM (Da):   %s   24055.35  
PI (pH):   %s   6.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTIGDSVPNLEVETTHGVIKLHDYIDTWTILFSHPGDFTPVCTTELGKMAAHAPEFAKRGVKLLGLSCDDVSSHAEWVKDIEAYPGCKVTYPIIADPKRELIKILNMVDPDEKDSSGHNVPSRALHIVGADKRIKLSFLYPASTGRNMDEVVRVLDSLERSSKNKIATPANWKPGEDVVISPSVSDEEAKKLFPQGFKTVGLPSNKGYLRFTNVDH*

Retrieve as FASTA  
Remarks COmplete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGCCTTACTATTGGAGACAGTGTCCCAAACCTTGAAGTTGAGACCACTCATGGAGTTATCAAGCTTCATGACTACATAGATACCTGGACCATTCTCTTCTCGCACCCAGGTTGT
GTCTCTGTTCTGCAACTGTTTTCTATGTTTTTTATAAGTTAATTAATGGTGTCCGAGTTGTAAGTTTTTTGCATGCAGGTGATTTCACACCAGTTTGTACTACCGAGCTTGGAAAGATGG
CTGCTCATGCTCCAGAATTTGCTAAGAGAGGGGTCAAACTGTTGGGATTGTCCTGTGATGATGTTTCGTCTCATGCTGAGTGGGTCAAGGACATTGAAGCCTACACT
GTAAGAATCTCTC
CTTCTAAACGATCGTTGTTAATTTGGGTTATTGGAAGATATTTAGTAGAACATGTAAGGGATTTTCTAGGTATATGGATGTACTGTCTCTGTTCTACATGTACTTATATTTTTTTTTTAT
CAGTAGTAATATTTTTTGATTCATAAACAATGAGTAATTATGTGCACAATTCGTGCATGCAGCCTGGATGCAAGGTTACATATCCAATAATTGCAGATCCTAAGAGGGAACTCATTAAGA
TACTTAATATGGTGGATCCAGACGAGAAAGACTCTTCAGGGCACAATGTTCCATCTCGAGCTCTGCATATTGTTGGTGCCGACAAGAGG
GTAAGCTCGAAAACCATAACTATTATCTCCC
ATTTTTTTTTAATATAAGTCGTTTGACTAGCAATAAAAAAAATTCCATTTTGCTTTCAAAAGTTTGAATTAATATCATTGGTAACTATATGTAAATATCAATTACTGAAATTGATTTAAG
CGACCATGTTTCGTCAACCAAATTCAATTAATTTTGGGATGATTTCATATCGTAGATCAAGTTGAGCTTTCTGTACCCAGCAAGCACTGGCCGCAACATGGATGAAGTAGTGAGGGTCTT
AGATTCTCTAGAGAGGTCATCAAAGAACAAGATTGCGACTCCGGCAAATTGGAAGCCAGGTGAAGATGTCGTCATCTCCCCTAGTGTCTCTGATGAGGAAGCTAAAAAGTTGTTTCCTCA
GGGATTCAAGACTGTTGGCCTTCCATCTAATAAAGGATATCTCCGCTTCACCAATGTTGATCATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGCCTTACTATTGGAGACAGTGTCCCAAACCTTGAAGTTGAGACCACTCATGGAGTTATCAAGCTTCATGACTACATAGATACCTGGACCATTCTCTTCTCGCACCCAGGTGAT
TTCACACCAGTTTGTACTACCGAGCTTGGAAAGATGGCTGCTCATGCTCCAGAATTTGCTAAGAGAGGGGTCAAACTGTTGGGATTGTCCTGTGATGATGTTTCGTCTCATGCTGAGTGG
GTCAAGGACATTGAAGCCTACACT
CCTGGATGCAAGGTTACATATCCAATAATTGCAGATCCTAAGAGGGAACTCATTAAGATACTTAATATGGTGGATCCAGACGAGAAAGACTCTTCA
GGGCACAATGTTCCATCTCGAGCTCTGCATATTGTTGGTGCCGACAAGAGG
ATCAAGTTGAGCTTTCTGTACCCAGCAAGCACTGGCCGCAACATGGATGAAGTAGTGAGGGTCTTAGAT
TCTCTAGAGAGGTCATCAAAGAACAAGATTGCGACTCCGGCAAATTGGAAGCCAGGTGAAGATGTCGTCATCTCCCCTAGTGTCTCTGATGAGGAAGCTAAAAAGTTGTTTCCTCAGGGA
TTCAAGACTGTTGGCCTTCCATCTAATAAAGGATATCTCCGCTTCACCAATGTTGATCATTAG

Retrieve as FASTA