Entry information : GgaPOX01 (EPO-like)
Entry ID 4039
Creation 2007-01-02 (Filippo Passardi)
Last sequence changes 2011-02-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-01 (Christophe Dunand)
Peroxidase information: GgaPOX01 (EPO-like)
Name (synonym) GgaPOX01 (EPO-like)
Class Non mammalian vertebrate peroxidase    [Orthogroup: POX001]
Taxonomy Eukaryota Metazoa Chordata Aves Phasianidae Gallus
Organism Gallus gallus    [TaxId: 9031 ]
Cellular localisation N/D
Tissue types Head
Ovaries
Testis
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GgaPOX01
start..stop
S start..stop
GgaPOX02 769 0 2..685 24..736
OgaMPO 753 0 37..686 34..717
FcaMPO 744 0 21..685 23..717
AImeMPO 736 0 32..686 29..717
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..7 7 N° 2 831..908 78 N° 3 1626..1719 94 N° 4 2260..2435 176
N° 5 4363..4486 124 N° 6 5541..5670 130 N° 7 6623..6739 117 N° 8 6826..7141 316
N° 9 7843..8003 161 N° 10 8176..8428 253 N° 11 9622..9792 171 N° 12 10928..11165 238
N° 13 11619..11841 223  
join(1..7,831..908,1626..1719,2260..2435,4363..4486,5541..5670,6623..6739,6826.. 7141,7843..8003,8176..8428,9622..9792,10928..11165,11619..11841)


exon

Literature and cross-references GgaPOX01 (EPO-like)
Literature Zamocky, M. et al. (2007) Phylogenetic relationship in the peroxidase-cyclooxygenase superfamily (in preparation). This record is predicted by automated computational analysis.
DNA ref. GenBank:   NW_001471508.1 (390716..402839)
mRNA ref. GenBank:   XM_415715.2
Cluster/Prediction ref. UniGene:   Gga.32214
Protein sequence: GgaPOX01 (EPO-like)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   695 (673)
PWM (Da):   %s   78315.73 (76072.4)  
PI (pH):   %s   7.35 (7.08) Peptide Signal:   %s   cut: 26 range:23-695
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSGIKLRIALLGSLVTFCLVGASDSSLNKGSEVLSDSFILKSISEAKQQVDAAYLRARKHLQQKLREEFPSPVDFLKHLKDPVGRTRSAVRAADYLETTLKLLKRKLQQSGRMRFNIDLLDRKQKEMISKETGCDYQIRSIKCPEDDTYRTITGECNNRKEPHLGVSNHAFARWLPAAYEDGVSVPRGASEGKLYNAFPLPWGQWVNHDIDLAPSSGMGANPELHCDADCTFRSPCFPIKFPPDDPRMLRSNSCMPFIQSASVCNPRTFTREQINAVTSFIDASMVYGSEESVAKSLRNQTNQLGLMAVNQNFTDAGLELLPFENKTKSVCVLTNKSTNIPCFRAGDKRVTENLGLSALHTVFLREHNRLVTKLGKLNPHWDGEKLYQESRNIIAAMTIITYRDYLPLLLAEETSKWIPLYSGYHETVDPTVSNVFSLAFRFGHTSVQPFVSRLDDSFQPMGSLPHVPLHLTFCASWRIIMEGGIDPLIRGMVVDHAKLMKQNQMLIEELQNHLFEQTEIMGLDLAALNLQRGRDHGLPGYNAWRRFCGLSQPQTVDELSEVLGNTELTKKLMDLYGTPDNIDLWIGAIAEPLIPRGRVGPLLACIIGTQFRNLRDGDRFWWENPGVFTPQQLEELTKISMSRVICDNTRIKKLPRDMFRASSPENFVDCHEIDMLDLSAWKDEPERGSKGT

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 19), 1 mRNA and ESTs. Annotated as "similar to myeloperoxidase" BUT important sequence & structural deviation from myeloperoxidase (Marcel). Positions: 234-782 heme peroxidase domain
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAGGTAAGATCAGTGCTTTTTATTTCTAAATCTGTATTTAGCCATTTTGATGTGACTGCTACTGGTATTGATGCTAGCGTTGGCTGAGCACAAGGAGATGGGANNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCACAAGGAGATGGGAAGATAGAGTAGAGCGTGAAGAGCCAGTGCTAATCCTTACT
TCCTCCTCCCAGCAGAGCTGAAACACACTTATTTTGGGAAGTGGGAAAAGGGAGCTCTCCTTCCTCCCCACTGCAACAGGTTCATTAGATCTTCCTTATTTTGCCTTTATTTCCTGTTTT
AAACAGTTAAGATGTTGACAAAATGACTTTTATGTGTACAAATATAACTGCAATCTTTTGGTTAAGTGTCTCCTTCCAGGGAAGCCGCTCTGCCATTGTATGTATGCTATACATATACAT
ATGTGCTGGAGGACCTGTGCTAGCACATCAGTCAATCCCTTCTGATGCTTCAGAGAATCCCTGCACATCCACTTACAGTGAACTGAAAATGATGTTGTGTTACCCTCTAGGTATAAAACT
GAGAATTGCTCTCCTAGGATCCCTCGTCACATTCTGCTTGGTTGGGGCATCAGACTCCTCGTTAAACA
GTAATTTTCTGTTTCTCACTCTGCTGCTCTTTTGCTTGAAGAGGTGTGGTGT
TGGGTGGGGGATTCAAGTCCAATCTCAGTCTGATTACCTAATTATAGTTTCAATATAGAATTGTAGAATCATTAAAGTTGAAAAAGATCTCCAAGATCACCAAGTCCAACCCCAACCCAT
CCCATCGTGCCCACTGACTATGTCCCTCAGTGGCACACCTCCTCAGTTCCTGAACACCTCCAGGAACAATAACTCTAAGGTATTTGAAATATGTCCAATATATTTGAAATTTACCCACTA
ACAGTGAAGTGCCTAAGAAGCTTATCTGTGTTGAGCCTTTCAAGGACATGAGTACCTTTTTATGGCAGGAAGACTGGTCACGGACCATATATTAGGTTTCTTCTATGCACAGCCCGAGTG
AATATCCCTCTTTACAGAAAATACCTTGAATAAGAAAGGTGAAAGTTAACTCCCTAAAAACCCCTTGAAGTCAAAGGAGTCAAGTTTGACATGGATAATAAAGTATAATTTGGTGGTCAT
CTATAGTCCCATAACTTTCCAAGCCTCAGCGGTGGGGTGAGGTAGATGAGTGAGAGGAACACAGATAAAGGTGTTAATGTAACACTAAACATATAGTGGGAATGTGATGCAGTGGGATGT
AGAGCTTCTCGTGTACATACAATGTATCCTCAATTTCTGCTTTTTATCCCTCTCTTTTTGAGTAGAGGGCTCAGAAGTACTGTCAGACTCATTTATCCTGAAGAGCATTAGTGAAGCCAA
GCAGCAGGTGGATGCAGCGTATTTACGAGCTCGGAAACA
GTGAGTCCTTTTTTGCATGAAAGTTCTAACATTATCAAGCAGTAAGAGATAACCTATGAAGGCTGCCCCGAAAGTAATGCC
TCCTGTTTTATGACATTGGCCCACAGTGTCAGAGGTGGATGTTGGTGGTGTGGCAGTGCAGGTTAACCTCTGGGGAGGGGTCTCTCTCTACCAGTGATCAATGTGGCCAGGAACAGAAGC
AACGTATCCAAGACTGTCTTCTGCTCATAGAATATATACTGTAACATCCTAAATGTAAAATTCTATCCTGTCATTGAAAAACTCAGTTTACCACCAATATTTATAGCTTTACACATAGAT
TAACAGGTCTCATTATGACAAGTATATAAAGCAAACCTGAAAGGAATTTTTTTTTACTGAGAGAGGGAGGTGTGCAAATCTGAGGAGCAGTCAGGCTGCTGTAGAAGAGCACAGCGTTCC
TGGGGACCTGCTGGTTCCATCATGTCTAAGTACACTAGCCCCACGGGGCAGAGGAGGTGTTTTCAGGGTAGGCAGCCCATGAGACTCTGTTCTGTTTAGCTTACAGCAAAAACTAAGGGA
AGAGTTTCCCAGCCCGGTGGATTTCCTGAAGCACTTAAAGGATCCAGTAGGAAGAACCAGATCTGCAGTCCGTGCTGCCGACTACTTGGAAACTACTTTGAAGCTCCTCAAAAGAAAGCT
GCAGCAGTCTGGGAGGATGAGATTCAACATTACAG
GTAACGCGTTTTAGACCAAAATAGCTTGCTAACAACAGAAAAGCTATCACAGCATGCATGTCAAAAAGCAGCTCTGCCATGGCCC
AAGTAGCTGATTACAAAGCCCTGGCATGATCCTGATAACTGGTCAGGAAGCCCTTCCCCAGAGTCCCTGCTGGTGTCACTTGACTGAAGGGTGCAGTGTGTGCAGAGGCTGAAAGGTAAC
CGTGCTCAGAGGCAGACCCAGACCACCTGGTGTTTCACTCATCAGCTTTGGTGCTGCCCATCTCAGCTCCTGTCTTTGATGATAATACCAACCTAGGCTGAGTGGAACAGTAACAGGGTT
GCTAAAAATCAGTGGGATAAATCTGGGGCTGAGCGCCAGGAGACTGCACCTTCTGAGCTGATCCACTGCTGATACACAAAAGTGTTTAGGCCTCAACTTAACAGGGAAAATCCAGGTGTT
ATCCAGATGTTGTATCTCCACAGTTCTGACCCAGCTCACAGCTCGCATCCTGTGCTAGAGAACAGGAAGGATCCACAGATGAGCAATTTCTTATCTATTCTGACTGAATGTTTCTGAGAT
ATCAGATCCTTCCAGGGGTGCACATGGTACACCCTGCCTTCTTCCCAGTGGTTTAATTACTAGAACAAAGAAAAGAACTGTCACATAACCTTGCTGATTAGAGCTAAACCCTGCTACAGC
TCAGGAGTGGTCTCTCTGGGCTCAGCTCTGTGCTGCAGAGCAGCTCCTCTGTGGATGGGGCTGCATCCATCAAGCTGACATGGACAATCTGTCAGTGTGAAAGACTACATTAGAGCTGAG
CTCTATGGTGTCATCTCTCACTTCTAAACCTCACCGTCCCACTACTAACTATGTCTCACATCTCATCAGTCCCTTTTCTTGGGGTGGGGTTTGTCCCAGCTGAAGTTGACTACACACGGG
GTAAGTTTTGGGTTGAACAGCGGTTCATTAGAGAGGTAAAGGCACTTGGCTGAAGGTGTTTTAACCCACACTCTTGGCAGCTGGCTGGGGAGGGCATCACTGAATCACAGAATGATTAAG
GTTGGAAAAGACCTCTAAGATCCCCAAGTCCAACCTCAGCCCACCCCCACCATGCCCATAACCATGTCCCTCCATGGTTATCCACCCACATCTCCATGGTTCTCGAACACCTCCAGGGAC
AGTGACCATCACCTCCCTGGGCAGCTGTGCCACTGCAGCACAGACATACTGGACTCTCCACAAACTCTGCTCAACAGGGGTGGATTTAGCTACTAAAGCAGAGTGACTCTGGATGAGCTG
ATGGTATGTGGCACAGTGAGAGACTCAGAGGCAGAAGTTATTCTGGGGAATTCAGGTTCTGATTATCAGCTGGTTTACAGCAAATTTTTGCATGTGTGCTCTTATACCAATAAATGCCAT
GGAACTAATATCTGTCATAAAATTAGGATAAGTGAAGACCTCCATTTGCTAGGTGAGTCATGGCCTGAGCTCTGTCAATGTAACTGCCCCTAGGATTCTAGTCTCTGGTTAACTCTGGGC
ACCTAAAGACAGTGCATGAACCCTCTTCATGGATGAGTCATTAAGCTCAGTCACTGAGCTCGCTGAAGCCATTGGACATTTAAAATCCTTGAGAAGGAGCGTTACCTGGTGGGATTCTGT
TTCTGACACTCAGTGCTCCCCACTCTGTGATCCCCACCAAGGCTCTTGTGCTGCTGAGAGGTGAAGTAGACAGATTCTGTTGGTGACAGAATGTATTCCACAGCAAGAGTGCATTTTCTC
CTGCTTTAAACTGGAGGGAGCTTGGAATAACATTAGATGCTGGTGCAGTTGGTGCTGACATTACTAACGATACAGAAAGTTTCAAACATCAGCTGAGAATGCTGAGAAGATAAAACACAA
TTTGTTAAGAGCAGATGTTGTTTTGCACCCTTTCTTTCGCAGACCTATTGGATAGGAAGCAGAAGGAGATGATTTCCAAAGAAACTGGCTGTGACTATCAGATCCGCTCCATTAAATGCC
CAGAGGATGACACTTACCGGACTATTACTGGAGAGTGCAACAACAG
GTAGGGCCTGTGATGTAACAGACATTTCATTTCTGCCTTAGTACAGGCAGGAAAAAGATTTCATGTCTTGAAAA
CATCAGGCTTGAGCCCATTGCTCTCCGTGTGCTCCTTCCCAAGAACTTCATGGGAGTGGGGAAAGGCGAAAAGTGGAGGAAAGAAGATCTGGGGGCCATGAAATTCAGCCCCACTCTATC
TCTTCTGTGGCACAGCAGTATTAATTCCCTCAGCCACTGGGAGACATCACGCTTTGAGTCTGGTGAGAGTGCTGATGGTTAGATTTCAAACTTCACATGTCTTAGGCTGAGTACAGAAGC
AATATTTTTAAAAGCGTGTGTCTCACGGGTGCTGTGAATATCAATACACCCCACCAAGTATGTCACTCTGTGACATGGGAACATTCTTAAAAGCTCTTGCTCAGCTTGAGATGCACAACA
TGAGATAGCACAGATATGTTCAGCGATTCTCTCACTGTGCATTCACACTTCAAATAAGGTCAATGATGCACTGGACCATAGCATTTGACCTGCAGTTAGAGGGTCCTCCAGGTTTGGACA
CCCCACAGTTCAAGAGGGGTGTGCAAAAACTGGGTAGGATTCAGCAGAGGACTTCCAAGATGATCAGTGGCCTCGGATGGACACAGGCATGGCTCCTCTGATAGTTGGTGATGGCCATAC
TGTGAGACTGTGAGTTTGTGTGGAGCAGCAGCAGAGACAGAGATGCTATGGAGATAGAAATTCCAAATAAAATTAATACGATGTCATCAGGAATCTTTTCGTGACGTTAAAAAGTTTATT
TTTATCCACAGTAATTATCTTGGTATTGCTTACTTCTCAATGTTTCCTGGCTATCACCCATGTTACTGGAGTGGTCAGATATGGACCAAGGGCTGCCAATCATGAGGGACATGGTCAGTG
GGCAATATTGGTGGTAGGTGAAGAGTTGGGCTGGATGATCTTAGAGACCTTTTAAAACCTTAATGGTTCTCTGATTTATCTCTACGAGCCTGTTCACTTCTGAAATAATACTGGTATTGG
CTTTTCTTCTGACGTTCCAGAAAGGAACCTCACTTGGGGGTTTCCAACCACGCATTTGCTCGATGGCTCCCAGCAGCATATGAAGATGGAGTGTCTGTTCCCAGAGGTGCAAGCGAAGGA
AAGCTTTATAATGCATTTCCACTCCCACTG
GTGAGAACAATTATTCTTGTCTGGATAACATTACTGAACTCTATCCTCACTGCACCCATTGGTTTGGAACATTGGCAACATCTAGAGTGT
AAAATGAATCCTCTTCTGTGACCTCAGGTGCAAATTATTTTCTCAAGTTGAGATATGTCTTAGACTCATGTGCTTGTCAGAGACAGAGGAAAAAATGATGCAAGTACTTCACTATGCAAA
GCATGGGCAAGAGCAAAGTATTTTCCAAGGCATACATCCTGAGGTTGGGTGCAGGCAGCACCACGCTGTGCTCAGGTATGCCAGGATTTTTGTACAGAGAGTAAGATTGGAGTGTTCCTC
ATAGAACCCTTCAAATTGGAAGGGATCTTTAAAGGCCATCTGGCCCAACACCCCTGCAATGCACAGAGACACCCACAGCTCCACCAGTGCTCAGAGCCCCTCCAGTCTGACCTTGGGTGT
CTGCAGGGACAGGGCACCACCACCTCTCTGGGTAACCTGTGCCTGTGCCTCACCTCCCTTTTGGCAAATACTTCTTCCTTATATCAAATCTAAATCTCCCTTCAGCCATCTTCTTGACTT
TCTGGGTATATGCACATCCCTTAGGTTGAGCTCAGGCTAAGGGATGTGCATATGTGTCATATGAGGCTTGGCTGGGTGACCGTGGAGTTAAGGCGGTGCTGCCAAAGGGCTGGAGGCTGT
ATATCACACCAGTTTAGGTCCAATTGGAACATGAGGTTGTTCTGTTTAATGCAATAATTAACTATTAAGGGCTCATTTGAGACCATCTTATCCATGGTCTCACAATGGGAGTTAGTCTGG
GAGGTAACTTCCCCTTGGTACAGACAGTCACACACATCTCAATTTTGATTTTCTGCAGGTTCGAAAAGTGTCTAATGAAATTGCTCATACAGCCAATGAGAACATCACTCAAGATCAAGA
GCTTTCTCTTTTCTTCATGCAGTGGGGCCAATGGGTCAACCACGACATAGACTTGGCCCCTTCCAGTGGCATGGGAGCGAACCCGGAGCTTCACTGCGATGCTGACTGCACCTTCAGGTC
CCCTTGCTTCCCAATTAAG
GTACCATGACTTCTGTTCCATCCCAGAACAAACAGACACAACCACAAGGCTTTCTCTGAGGCGTTACTTATCTTTATTTCCTTTAGTTCCCCCCCGATGAC
CCGCGGATGCTGAGATCAAATTCCTGCATGCCGTTCATCCAGTCGGCTTCCGTCTGCAATCCCCGGACGTTCACTCGCGAGCAGATCAATGCCGTCACCTCCTTCATTGATGCCAGCATG
GTGTACGGCAGCGAGGAGTCTGTGGCAAAGAGCCTTAGGAATCAAACAAACCAGCTGGGTCTGATGGCTGTGAACCAGAATTTTACTGATGCTGGGTTGGAATTATTGCCCTTTGAGAAC
AAAACAAAAAGTGTTTGTGTACTCACAAACAAGAGCACGAACATCCCCTGCTTCAGAGCTG
GTAAGGTGCATCTGTAGAGCAATTTTGACTCTTTTGTTGCCTGTGAGAAGAGTCTTTTG
GTGCACGAGGAGAGACTCAGTGTTTGTACCTTCAGCTGTTGGAGGGACTTCACCATGTGTCTCCCAGTTGCCTCCACCATTTCTGCTGAAAGCACATTCATAGATCTCTCAAAGGTGTTT
ATAACTTGAGGGAGCTGAGACAAATTTTCAAAACCAAACATTCATACAAAGGAAGATTGCTAGAAGCCATAAGGTACAAGAAGAAGACAGATATGAGATTGTCACAAAATGAGATATTTA
CAGCTGCTTCATGAACAAGTGCAATTTAGTTCAAATTGCCCAAAGCCCCTTCTCACCATCCCTGGGTGTGGAGATATGACAAGAAATGTGGAGATATGGCACTGAGGGACATGGTCAGTG
AACAATATTGGTGATAGGTGGGTGGCTGGACTGCATGGTCTTAAAGGTCTTTTCCAGTCAATGATTCTATGGTTCTCCAATGGTTTTGGCTAAATTATTTGGAGAGGGAGAGAGAGAATG
CTTGGTCTGTGCTGCAAAGAAATTTCTGGCATGACTGATGACTGCTAGAAAACTTAACAACAGGCAGTACTGCTAAGAATGCTACATATCTGCCCTGCCATCAAAATCTGCTGTGGAAAT
ATAAAGCAGTTGACCAATTTCCTAAAACACTTTCATTTGTAGGTGACAAACGGGTAACAGAGAACTTGGGACTTTCTGCTCTGCACACCGTCTTTCTCCGAGAGCACAATCGCCTGGTTA
CAAAGCTGGGGAAGTTAAATCCTCACTGGGATGGAGAAAAGCTTTACCAGGAGAGTCGAAACATCATAGCTGCCATGACCCAG
GTAGTGACCAATGCTCATCTTAGAAATCTTTTTCCTC
CTGCAAATGCAGCAAAATAATCCTTTGAAGAACTCATGGAGATTGCCAGTTCTCTTTGAATTTAATGTCATTTCTGCTGCAGCTGCTGATTGTTTGATCTACTTTTATGTTTGTTTGTTT
GTTTGTTTTTTCCAGATAATAACATACAGAGATTATCTACCACTTCTGCTTGCAGAGGAGACCAGCAAGTGGATACCCTTGTACAGCGGCTACCATGAGACTGTGGATCCGACAGTGTCA
AATGTTTTCTCCCTGGCCTTCCGATTTGGTCATACCTCAGTGCAGCCTTTTGTATCCCGTTTAGATGACAGCTTTCAGCCTATGGGTTCACTTCCCCACGTCCCTCTCCATCTGACGTTT
TGTGCATCATGGAGAATTATAATGGAAG
GTAAGAACTCAGGGCTGCCAGCAGTCCTGATTTGGTCCTGAAGTAGACTCTCAGGTGCAGATATGCTGGTAAGACACTCGAGCATAGACTCA
CAAAAATTAGAACATTTAATTGGTTTCACCACTTATCATGCCATTCATCTTGGAAGCAGACATGTCTCCCCAAGAGGCTCGGTGGTCTCCTAGATGTGGGACATCAGGACAGTCCTGTAG
AACTGTCTCCAAATGCAGCCCAACAACACTGGCCCTGCACTGTAGCCAGGTGAAGGAGCCCTGTCAAAAGCTGTATGTTGTAATATTCAAGCCATTGGATGCTGGCAAGCACCAACTCCA
ACCATGAGAAGCCATTTCAGATTTTCCATCAGAACACATAATTCTGTACCTTCTTTCACAGTGCCAAGTATCACTCAGTCAAAATGTAGGCCAGTGAAAACAAACTGTTTATATCCTTCT
GTAACTGGTAGGGATTGTCAGAGGGTAATGCATCCAATCCAGCTGAGCTCAGATGGGATAACTGCTTTCTGATGATGGCCCTCCCTCTCCATGACTTTAAAGGGAGTTGTAGGATCCAGC
TCTTAGACAGTTAATGTCTTCAGGCATGAATCTTCCCAAGAAAGATGGTTGCCTCTTCCAAAATGAATTATCTTACTATAGAAAATATTCTGAAGTATACAAATTCAGTCATTTTTGCTG
TGTTTTAGTGGTTCTGTCTTCTTAATGGCTATGAAAAATACATACAAAAACAGACAAAAACTGATTTCAGTTTCACATTTCACGTTCTAAAACATATTTGCCAACTGATACGTCATTCTA
AAGAAAAACAAAATGCTAAACAAAACATTGGATAGAACCCCATGCATCAGAACTTGCTGGGAGCTGACTGGTTGAGGAGCAGCTCAGCAGAAGAGGACTGGGAGGTCCTGGCGGGTAACA
AGTGGATGTATGTATGCAGAATAGAAGGCTGAGGGAATGGGAGAAGTAGGCAGTATAGTTGCCAAGGGGAAGCCTCATCAACTGGGTTTTGCAGATTCATACATACGCACTTTCATGTGT
TGGAATGGAAATGTGAATCTAGGTGAGCACACTGCTCAGAGTAGAAGAAACATCTAACACAGCACTGCTCCGTCTGCTTGAAAGAGACCACCAAAGTTGGAACTTGGCAAGAAGTCTCTT
TTTGATCTGCAATGAATACAGGTGGCATCGACCCACTGATACGTGGCATGGTGGTTGATCATGCAAAACTGATGAAACAGAATCAAATGCTCATTGAGGAGCTCCAGAACCACCTTTTTG
AACAAACAGAGATAATGGGTCTGGATCTAGCAGCTCTGAACTTGCAGCGGGGAAGAGACCACGGACTTCCAG
GTAAGGAGACTCTAGGCCTGTCCTGTGGACAATACTCCTTTTCCTTTA
CTGGTTATAGCATCTCTGTGAATGTAGACCTGTGGGGGGAAAAAAAAATGATACTTTGATTTGAGATGGCAGTCAGATTCAGAGAAGGAGAGGTCTTTATATTGTAAAGATCTTTCTCTG
GGGGATTTACAAAGAGTGTAAGAAGGACTTGAGAGGCAAACGTGATATTTGGAAAAATTTGTTAAAGATGGGTAGAAGCAATGGTGTACTGCAAAGAAAGAGTGAGGGGTAGAGCAGATA
CAGTCCCAATTGACCAAGCTCAGTTTTCACATGAGCTCAACAAAGCATATGCTCTTTGCCCACCAAGACTTGTTTCATGTCTTCAGACAACCCACAGCTCTGAACAGAAGTGGCATGCAC
CCTCGGTGGTAATTGCCTCCACGTGCTGCAGAGGAATGGGTGTTTTGGGGGTAAGCACAACCACAGAGGTGCTATTTGCTAGGTTTTTAATCCTAGAAATGTTGCCTCCCAAAACTGTAA
GAACAGGTCCAGTCATGCTCAGCACCAAGTGGCTTGAATTGGCGGGTTATGCTGAACCAGTGGCAGAGCATACAGACCCAAAATATTCGTTTAGTGTATGCATTCCTTAAAAGGCATTTG
AAAACCCTAACTCTAACCCTAACCTTAACCCCAAACCTCAACATAACCCTAAAACTAACCCAGACTCTAGCAGCAATAGTAACCCTAACCCTAAATCCCAACCCTAAACCTAATGAAAAC
CCTAACCCTGATCCTAAAACAAACCCATACCCTAAATCTTAAAGGTAACCATCACCCCAGCCCAGAAACACTAACCCTAACCCAAACAAAACCCTAACCCTGCACCAAATCATAACCCTA
AGCCTAATCCTAACACTACTCAAACCAAACCCTAACCCCAACTCTAATCCTAACCCTAACACTAAACCTTAACCCTAACATAGCATTTGTTGTGACTGTTTCTATCTAGCTAAGAACGTC
TTCCAGAACCTTTAGTACCATAGAAAGATGCAGATGCTGCTGAGGGTAGTGGGGCTTGTTTAGCTCTTAGCCTAGGCAGACAGGTGGACAACATGGCCTCTGAGCAGCTTCTGTCCCCGT
TTCGCAGGTTACAATGCCTGGAGGCGCTTCTGTGGGCTCTCCCAGCCTCAAACAGTGGATGAGCTCTCTGAGGTGCTGGGCAATACCGAACTGACCAAGAAGCTCATGGACCTGTATGGG
ACACCGGATAATATTGACCTCTGGATTGGGGCAATTGCAGAGCCCTTAATTCCCCGTGGCAGAGTTGGGCCCCTCCTGGCTTGCATCATTGGCACTCAGTTCAGGAACTTGCGTGATGGA
GACAG
GTAGGTAGCTCTGGGAGCGTGCCATCCCCACCCCACGGCCAACGTATCACTGAGCACTTGCAGCAGGGCTCGCACTTTGGTTTTAGCCTCGATTGCCAAAGGGCTCTTTCTTAAC
AGCTGATTTGTAGAGACACACATGGCTGAGGAATGCCAGCTCCAGCCCATGGGTGATCTGCAGTAATCTCTGCCTGAGGTGACATCTGCTCTCAGGGTACTAATGGGAAGGATCAATCCC
TGTGTCCTAGTTAGGCTATGTTAAAGAGGCAGCCTCTTTGCACAGGCAGATGAGTACAGCAGGATTCAGACTTCTTTCCAAAGGGTTGTGCCTACTGCCTGATGGATGAAGGTGGATCTG
AGCAGAGATTCACCTGGGCCAGGTGAATATTTTGGGAAATAACCAACACTTAACACCTTCAAGGACACTGTAAGTTGCTTCTGAAAATATCCTTGCAGGTTCTGGTGGGAAAACCCAGGA
GTTTTCACTCCGCAGCAGTTGGAAGAACTGACAAAAATCTCCATGTCAAGAGTGATCTGCGACAATACCCGTATCAAAAAGTTACCCAGGGACATGTTCAGGGCCAGCAGTCCTGAGAAC
TTTGTTGACTGCCATGAGATTGACATGCTCGATCTCTCAGCCTGGAAAGATGAGCCTGAGAGGGGCAGCAAAGGTACGTAG

Retrieve as FASTA