Entry information : OsDiOx01 (Os12g0448900)
Entry ID 4159
Creation 2007-01-31 (Filippo Passardi)
Last sequence changes 2007-01-31 (Filippo Passardi)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2010-08-03 (Marie Brette)
Peroxidase information: OsDiOx01 (Os12g0448900)
Name (synonym) OsDiOx01 (Os12g0448900)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Flowers
Leaves
Roots
Stems
Whole plant
Inducers Hydrogen peroxide
Magnaporthe grisea infection
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value OsDiOx01
start..stop
S start..stop
OsiDiOx 1271 0 1..618 1..618
HvDiOx 1177 0 1..618 1..617
ZmDiOx01 1167 0 1..618 1..619
CclDiOx02 887 0 10..616 16..623
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15380962..15381051 90 N° 2 15379892..15380155 264 N° 3 15378986..15379135 150 N° 4 15378410..15378543 134
N° 5 15378020..15378233 214 N° 6 15377674..15377819 146 N° 7 15377275..15377502 228 N° 8 15376035..15376237 203
N° 9 15375304..15375547 244 N° 10 15374814..15374997 184  
complement(join(15374814..15374997,15375304..15375547,15376035..15376237,1537727 5..15377502,15377674..15377819,15378020..15378233,15378410..15378543,15378986..1 5379135,15379892..15380155,15380962..15381051))


exon

Literature and cross-references OsDiOx01 (Os12g0448900)
Literature REFERENCE 1 Matsumoto, T., Wu, J., Kanamori, H., et al. (2005) The map-based sequence of the rice genome. Nature 436, 793-800.
REFERENCE 2 Zamocky M. et al. (2007) Phylogenetic relationship in the peroxidase-cyclooxygenase superfamily (in preparation).
Protein ref. UniProtKB:   Q2QRV3   Q9M5J1 [Other strain]
DNA ref. GenBank:   NC_008405.1 (15381051..15374817)
Cluster/Prediction ref. UniGene:   Os.2371
Protein sequence: OsDiOx01 (Os12g0448900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   618
PWM (Da):   %s   70233.85  
PI (pH):   %s   7.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSGLFKPRVHPDLRDVFSKMSFFDKIGFLFIHAFDKRNLWHKVPVPIGLLYLNTRRTLLEKYNLLAVGRSSHGALFDPKEFLYRTEDGKYNDPHNAEAGSQNTFFGRNMEPVDQQDELMSPDPFVVATKLLARREYKDTGKQFNILAAAWIQFMVHDWMDHMEDTGQIGITAPKEVANECPLKSFKFHPTKELPTNSDGIKIGHYNIRTAWWDGSAVYGNNEERAEKLRTYVDGKLVIGDDGLLLHKENGVALSGDIRNSWAGVSILQALFVKEHNAVCDAIEEHPNLSDEELYRYAKLVTSAVIAKVHTIDWTVELLKTKTMRAAMRANWYGLLGKKIKDTFGHIGGPILGGLVGLKKPNNHGVPYSLTEEFTSVYRMHSLIPSTLKLRDPTGQPDANNSPPCLEDIDIGEMIGLKGEEQLSKIGFEKQALSMGYQACGALELWNYPSFFRNLIPQNLDGTNRSDRIDLAALVYRDRERSVPRYNEFRRRLFLIPIKSWEDLTSDKDAIETIRAIYGDDVEKLDLLVGLMAEKKIKGFAISETAFNIFILMASRRLEADRFFTSNFNEETYTKKGMQWVKTTEGLRDVINRHYPEITAKWMKSSSAFSVWDADY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 12, 10 introns) 3 mRNA and 226 ESTs (UniGene and TC from TGI): mix between Indica and japonica
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCAGGACTCTTCAAGCCTCGTGTTCATCCGGACCTCCGTGATGTTTTCTCTAAGATGTCTTTCTTTGACAAGATTGGCTTTCTAGTACGTTTTTAATTAATTTTTAAGAGTAAT
TTATATATCAAGTATTTATTTGATGTACATACTGCATACAATATACACATACATACCTATTCCTTAAGAATATCAGGTAATGATTATATATTAATGTCTGATCATATATAGGAATTATGT
GTTATGTATGAAAATTAATCAGTATGCATGTAATTGATGTGGTCATCTTTTTATTTTATAGCAAGATAAGGGTGTTAATTAGAGAGGATGCATACATATATAGGTGAGCACTTCAGTTAA
TTACATCTTGGCATTAATGAAGTGTTATTTTTATAATAAAATAATTGATCACATATAATATATATAACAATTCTAATGCAACAAAAAATAAATTATATTTTGAGCTAGCGATGCAGGATT
TTAATTGTTTGATCTGTTTTAATTAATATCTCAGGTGTGTGTGTGTGTTGTCTATATATATATATCTCAAAAAATACGCCAAATTAAGTTTGATGCACCATTTAATTAGGGCAATCCGTT
ATAATTAAGTATATTTTCAAATGAGTATGTGTGTCAATATGTAATATTTTTTCCCCTGCATATCCTGGTAATTAACAAATTATGTTCGTATAAATATGGCCATTATAGAAGCACGCATAT
ATACATAAGCTTGATCATGCTTGTGCACCACCTTATTAACTACTCAAGTTATTTGAAGCTTTCCAATTGATATTCCTCATTAGTACGTTGAAGTATTTAATTTTACATATGCACATATAC
CTAATTAAATTCCCAATGTATTAACTAATTAACTCTTGTTAATTTCGTTCATGTAGTTCATTCATGCATTTGACAAGAGAAACCTGTGGCACAAGGTGCCTGTTCCGATCGGTTTGCTCT
ACCTGAACACCCGCCGGACCCTGCTCGAAAAATACAACCTGCTAGCTGTTGGGAGGAGTTCTCACGGTGCTCTGTTTGATCCCAAGGAGTTCCTGTACCGCACCGAGGATGGCAAGTACA
ACGACCCCCATAATGCTGAGGCTGGTAGCCAAAACACCTTTTTTGGGAGAAACATGGAGCCGGTTGATCAACAGGATGAG
GTACTACTTCTATTTTACAAATTTTCTTACAGAATTCTAA
ATTTCTAAGTTCTAACAGTACAAGTTAATAGCTTAATTAAGCACTTGTTTCCCTAAAGTCCAGCCTGTATCTAAGCATGTAATAGGGATAGTACTGCTAGGGTGTCAGCTAGCCTTACCT
AGCTAACATGTTTTACTTACCTGTTTTATACTTGCTTTTACTACATGTTCTGCCATCAACTTTTTTATGGGATGGAGGGGGTATATGGTACGATCGACCAGGACAAATATGCTAAGCCTG
ATCTAATCTCGGCCGGACCTGATCTATATTTACCAGCTGATTTCAATTTTCATCCCTATTATCTTGTTCAATAGAAAATTAGATACCATATATATTGAATTTAGTTAATGAAAAATAAAG
GAGTAAAGATCACCAAAAAAGTGGTTGATTTTTATTTCTAATTTAATATCTAGTTTGACAGTTTGACTTTAAGACTTTATAATAACACTCTTTTTTATGAAACTTTTGTTTGGTAGTTCG
TTCTGCATGCTTCAAATAAGTAAATGAATGAATTAACATTGAAACTCAAAAAAATAAGACGCGAGTTTTGTCAGTATATATTAAGATAAGAGCTAATTAATGTGCTTGTTAATTTAAAAA
TAGAACCATTTTCTTTTTAATTAGATCATACTGTTAACAGATGGAAATTTGAGGTACACTTTTAAATCATCAGGTTAATTATGCTTAACATAATTAGCTGTTATTTATCGGCGCAGTTGA
TGAGCCCAGATCCATTTGTTGTGGCGACAAAGCTGTTAGCCAGGAGAGAATACAAGGACACAGGGAAACAGTTCAATATACTAGCAGCTGCATGGATACAGTTCATGGTTCATGACTGGA
TGGATCATATGGAGGATACCGGACAG
GTGCATGCTTGATTTAATTCCTTAATTTGAGAGCCTTAAGTTGTTGAAGTCTTAAAATTAAATCTTCATCTTCCATTGAGATTTTGAAATATAT
ATTGTAGTTACATGTGGCAAATCGGGCGGGCGGGTCAGGTTCGGGTTGGACGGGTTGGGTTAGTTTGACCTTCTAGAATATCTCGGGTCGGGTCGGGTCGGGCCGATTTCAATATCAACA
TTTTTTTTATCGTATGTTGATTTGAGTTGGATTGGATGCTATTTGATATCGGATCGGGTCAGTTTTGGATCATATCGCGAGTCAGGTCAGGTCAATTTGATTTTGGAAAACGTCATGTCT
GGTCGGGTCAGATTCGAGTCGAGTCGAGCAGATTTCTTGGGTCGGGTTGGGTTCTACCACCTCTAATTGCTAGTTGATATATAATTCAATTTTCTTGGTTTCTTCTAGATTGGAATCACA
GCTCCAAAAGAAGTGGCCAATGAGTGCCCACTCAAATCGTTCAAGTTCCACCCCACAAAAGAACTGCCTACGAATTCTGATGGAATAAAGATTGGTCACTACAATATCCGCACAGCTTGG
TG
GTGAGTAATGCTTAAGATTTTCTCGAGTTAAGATCTTTATCAGAAATTTATCTTAAGCACAAAGAATGAACTTAAAAAATAGAGACAATCGATGTATATATATAAATCAATGCATATT
TGCCCATAAAAAATGTCGTAATTTTTTTTTTGCAATTTCTATAATTATATATACCAAGGGATGGGAGTGCAGTATATGGTAATAATGAGGAAAGGGCAGAAAAGCTCAGGACTTATGTTG
ATGGAAAACTAGTGATCGGAGATGACGGTCTTCTTTTGCATAAGGAGAACGGTGTGGCATTATCCGGCGACATTCGCAACAGTTGGGCTGGTGTTTCGATCTTACAAGCTCTTTTTGTTA
AGGAACACAATGCAGTTTGTGATGCAATAAAG
GTAAGCGAATATATCATCACTATTTTCTATTTGTTTAGTTTTAGGAAGAATATAATTTGCTGTTCTTGACTAGCTTGCCACTGATTGT
CTATTTGTTTAGTTTTAGGAAGAATATAAACTGTTATTTACCAAAACATTAATTTGTTTTCTTTATGCTATAAATATGAAGAAAAGATTACAAATGTTTTTTTTAATCTCAGGAAGAACA
TCCCAACCTATCAGACGAAGAATTATATCGGTATGCCAAATTGGTCACTTCTGCTGTTATTGCAAAGGTTCACACTATTGATTGGACTGTCGAGCTTCTCAAGACAAAAACCATGAGAGC
TGCAATGCGCGCAAATTG
GTGAGGATGCATTTATCTCATTTTCTCATATTTGCCGAAAGAAAAAAAATATAACCATTGATGCGGGTATTACTTTTCCAAGTGGAAATTTTATTTACATCT
GCAAATTCAAATTAATTAAATTAGTGAGAATGTGTACAATTTACCTGATATTCTGATTCTTTTGTGAAGGTATGGATTATTGGGTAAGAAAATAAAAGACACATTTGGTCACATAGGAGG
ACCGATATTAGGTGGGCTTGTGGGACTGAAGAAGCCGAACAACCATGGCGTACCTTATTCTTTGACTGAAGAGTTTACCAGTGTTTACAGAATGCACTCCCTAATACCAAGCACTCTCAA
GCTCAGGGATCCGACAGGGCAACCCGATGCAAATAATTCCCCACCATGCCTGGAAGA
GTGAGTAAACAATTTAGGCCTCGTTTGGTTGGGGAAAATTTTTAGTTTTGATTGTCACATCGG
ATATACGGATATACATTTAAAGTATTAAACGTAGTCTAATAACAAAACAAATTACATATTTCGCTAGGAAACTGCGAGACGAATTTATTAAGCCTATAATTAATCCGTCATTAACAAATG
TTTACTGTAGCACCACATTATCAAATCATAGCACAATTAGGCTTAAAAGATTCGTCTCGCAATTTACACGCAATCTGTGTAATTTGTTTTTTCTACATTTAATACTTCATGCATGAGTCC
AAAAATTCGATGTGACAGCGTGAAAATTTTTGTTTTGGGAACTAAACAGGGCCTTATGTTTGGCATCCATCCCTCTCATTTTTTTAATGTGGAAGATGAAATGCAAACTAACAACTTCTA
TTTATTAAATCAGATAGAAAAATAGTAGATTATAAAAAAATAACGAAAAAAAAAAGTTAAGGCCCTGTTTAGATCCTCCAAAATGGCAAAAGTTTTGCCATTTTGTAGCACTTTTTGTTA
TTTTGGATCTAAACACTAGTAGCAAAAGTTAGCAATTTAGCATTTGGCATTTGCTAGTCCATAGTAGCAAATTGTGCCAAAAAGTGCTTTGGGACCACTTCCTCTCTCTTTCTCTCTCTC
ACTTTAGTGCTAGAATGGCAAAACTTTAACATGCATCTAAACACTAACTAGTACTTTTGCAATGCCAAAACTTTTGCCACCAAAACTTTTGTCATTTGCCATTTGCCATTCCAAATGGAT
CTAAACATGCCCTAGGACGTTCTCCTATTACATATCGACTCTTAATTACATCATTGATTACTGAACCTGACTTTAGACACTGAACTCGACACAAACGGCTAGATTTGTTATTATTTTTTT
TAGCTTCTTGGCTACACAATAAAAAGTAGTAGAATGTATAATCTTGGTCACAATAAGTTTTCTGCTCGGTTAGCACATTTTTAGTATAACTGACATAAACACTGACACCATTTCTTTCTT
GTGTCAAAATGTAGCATCGATATTGGAGAGATGATTGGTCTCAAGGGGGAAGAACAGCTATCAAAAATAGGGTTTGAAAAACAAGCATTATCAATGGGATATCAAGCTTGTGGTGCACTT
GAACTATGGAACTATCCAAGTTTCTTCAGGAACCTCATTCCACAAAATTTGGATGGTACCAATCGATCTGACAGAATCGACCTTGCTGCCCTAGAAG
GTATAATTAAAATTTAGACTCAA
TTTATACCACTACCAGTAGAGGATCATGATTTTGCACCATGTCAAGTTGGTACAAGCTAGGGTCCACCAAGAATAATCCAATGCATAAAAATATTGAAAATAACTCACACTGGCAACAAA
TGAAGTGCTAGAACAAGTATTGTGACCTTAATTAAACTACTATGTTGAAATTTATCACAACATACTTTTCAATTTTCAAGAATTCTCGAACTATTATTGTACTAACCAGATTGAAAATAC
AAGATTCTCTTACCGAGACATATATCATGTTTGTATATGTTGTAACCTTAACTAGCATTTATTTAAAAAACAAGGACATTGCTGCGTACTAGTATAAATAAAAATGTTAAGCAAAAACTG
TACTATCCAAGTTAAGTAAAGAGGACATTGTACTGCTGTGTCTAATGCCTTTTGACAATGATTACACTGAGATTAATATCATTTTCTTTTCCTCTAAATTAAAGTATACCGAGACAGGGA
GAGAAGTGTACCAAGGTACAATGAGTTCAGGAGGAGACTATTTCTGATTCCAATAAAAAGCTGGGAGGATCTGACAAGTGACAAGGATGCAATTGAAACCATAAGAGCAATATACGGAGA
TGATGTAGAGAAATTGGATCTTCTTGTTGGTCTTATGGCAGAGAAAAAAATCAAGGGATTTGCCATAAGCGAAACAGCATTCAACATTTTCATTTTAATGGCATCAAG
GTAACATTTAGT
TCTAACTAATATTGAATGCTAGACAAAGTACCAATTTTTGTTTAAGCCCTTGCTAAACGTATTAGGCAACAACCGAGAATGTGGCTTAAGCTTATTTTGAGTGATTCAAAATTTACCCAA
ACCAAAGTTTATTAAGGCAAGAAAATATAACGATGTGACCATTATATATGGGTACATTACTGGTAGATCCAGAATGTTACCAGAAAAAAAAAGAAGTCAAATGTGGAAGTACTAATTATA
GATGATAACCACTCAGTTAAGATATGAATATTAATTTAACATCTCTAAAAACAGGAGGCTCGAAGCAGATCGATTTTTTACAAGCAATTTCAATGAGGAAACATACACCAAGAAGGGGAT
GCAATGGGTCAAAACAACAGAAGGCCTACGAGATGTGATCAACCGGCACTACCCTGAAATCACTGCCAAGTGGATGAAGTCCTCTAGTGCTTTCTCTGTGTGGGATGCAGACTACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCAGGACTCTTCAAGCCTCGTGTTCATCCGGACCTCCGTGATGTTTTCTCTAAGATGTCTTTCTTTGACAAGATTGGCTTTCTATTCATTCATGCATTTGACAAGAGAAACCTG
TGGCACAAGGTGCCTGTTCCGATCGGTTTGCTCTACCTGAACACCCGCCGGACCCTGCTCGAAAAATACAACCTGCTAGCTGTTGGGAGGAGTTCTCACGGTGCTCTGTTTGATCCCAAG
GAGTTCCTGTACCGCACCGAGGATGGCAAGTACAACGACCCCCATAATGCTGAGGCTGGTAGCCAAAACACCTTTTTTGGGAGAAACATGGAGCCGGTTGATCAACAGGATGAG
TTGATG
AGCCCAGATCCATTTGTTGTGGCGACAAAGCTGTTAGCCAGGAGAGAATACAAGGACACAGGGAAACAGTTCAATATACTAGCAGCTGCATGGATACAGTTCATGGTTCATGACTGGATG
GATCATATGGAGGATACCGGACAG
ATTGGAATCACAGCTCCAAAAGAAGTGGCCAATGAGTGCCCACTCAAATCGTTCAAGTTCCACCCCACAAAAGAACTGCCTACGAATTCTGATGGA
ATAAAGATTGGTCACTACAATATCCGCACAGCTTGGTG
GGATGGGAGTGCAGTATATGGTAATAATGAGGAAAGGGCAGAAAAGCTCAGGACTTATGTTGATGGAAAACTAGTGATCGGA
GATGACGGTCTTCTTTTGCATAAGGAGAACGGTGTGGCATTATCCGGCGACATTCGCAACAGTTGGGCTGGTGTTTCGATCTTACAAGCTCTTTTTGTTAAGGAACACAATGCAGTTTGT
GATGCAATAAAG
GAAGAACATCCCAACCTATCAGACGAAGAATTATATCGGTATGCCAAATTGGTCACTTCTGCTGTTATTGCAAAGGTTCACACTATTGATTGGACTGTCGAGCTTCTC
AAGACAAAAACCATGAGAGCTGCAATGCGCGCAAATTG
GTATGGATTATTGGGTAAGAAAATAAAAGACACATTTGGTCACATAGGAGGACCGATATTAGGTGGGCTTGTGGGACTGAAG
AAGCCGAACAACCATGGCGTACCTTATTCTTTGACTGAAGAGTTTACCAGTGTTTACAGAATGCACTCCCTAATACCAAGCACTCTCAAGCTCAGGGATCCGACAGGGCAACCCGATGCA
AATAATTCCCCACCATGCCTGGAAGA
CATCGATATTGGAGAGATGATTGGTCTCAAGGGGGAAGAACAGCTATCAAAAATAGGGTTTGAAAAACAAGCATTATCAATGGGATATCAAGCT
TGTGGTGCACTTGAACTATGGAACTATCCAAGTTTCTTCAGGAACCTCATTCCACAAAATTTGGATGGTACCAATCGATCTGACAGAATCGACCTTGCTGCCCTAGAAG
TATACCGAGAC
AGGGAGAGAAGTGTACCAAGGTACAATGAGTTCAGGAGGAGACTATTTCTGATTCCAATAAAAAGCTGGGAGGATCTGACAAGTGACAAGGATGCAATTGAAACCATAAGAGCAATATAC
GGAGATGATGTAGAGAAATTGGATCTTCTTGTTGGTCTTATGGCAGAGAAAAAAATCAAGGGATTTGCCATAAGCGAAACAGCATTCAACATTTTCATTTTAATGGCATCAAG
GAGGCTC
GAAGCAGATCGATTTTTTACAAGCAATTTCAATGAGGAAACATACACCAAGAAGGGGATGCAATGGGTCAAAACAACAGAAGGCCTACGAGATGTGATCAACCGGCACTACCCTGAAATC
ACTGCCAAGTGGATGAAGTCCTCTAGTGCTTTCTCTGTGTGGGATGCAGACTACTAG

Retrieve as FASTA