Entry information : MtPrx82 (Medtr2g067440.1 [4.0])
Entry ID 416
Creation 2005-08-11 (Christophe Dunand)
Last sequence changes 2014-07-30 (Christophe Dunand)
Sequence status complete
Reviewer Harold Duruflé
Last annotation changes 2016-06-17 (Harold Duruflé)
Peroxidase information: MtPrx82 (Medtr2g067440.1 [4.0])
Name (synonym) MtPrx82 (Medtr2g067440.1 [4.0])
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx82
start..stop
S start..stop
GmPrx270 553 0 7..389 5..384
GmPrx168 534 0 3..389 2..383
VvPrx90 455 6e-161 8..389 4..375
PpePrx50 451 2e-159 57..384 8..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28215616..28215930 315 N° 2 28215218..28215403 186 N° 3 28214744..28214909 166 N° 4 28214012..28214514 503
complement(join(28214012..28214514,28214744..28214909,28215218..28215403,2821561 6..28215930))


exon

Literature and cross-references MtPrx82 (Medtr2g067440.1 [4.0])
Literature He,X.-Z. et al., unpublished
DNA ref. Phytozome 12:   chr2 (28215930..28214012)
Cluster/Prediction ref. Phytozome Gene 12:   31066846
Omic ref. Gene atlas:   Mtr.32452.1.S1_at Legoo:   Mtr.32452.1.S1_at
Protein sequence: MtPrx82 (Medtr2g067440.1 [4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   389
PWM (Da):   %s   43648.83 Transmb domain:   %s   i5-27o
PI (pH):   %s   7.47
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRRFFIFNTWILVAFIAVLPVLLSLRTTSFNFYHTSFRSVKLAGIFPFDFSESIRDGSNLRYNFYKDSCPEAENIVRSAVTDIYSDHRDLAPSLLRLFFHDCFIQGCDASLLLEDRNISYEKQAIPNQTLKGFDKVDLIKEEVEQACPGVVSCADILALAARDSVFLGGGPFYPVLTGRRDSLQSFFQEAADQIPRPDDNITRTLHLFNLRGFKARETVSLLGEHNIGKIGCDFIQQRLYDFQGTGQPDPSIPLDFLSQMRQNCPDNNKNNVSSNGMFSTFTVSKPMNVHHSNNKGMSYKQALSSAVSSGASFDTHYYQRLLRGRGLLFADQQLMAEEKTAKLVSAYASDDGSTFRMDFARVMMKLSNLDVLTGNQGQVRLNCSRVVSS

Retrieve as FASTA  
Remarks Complete sequence from 1 EST and genomic (chromo 2, 3 introns).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGAAGCCAT AATGGTACTT TGTGAATCTA GTGATGACAA TTCAAGTGTG AAAAACAAAG GATTTTTCAG CACAAGATCT TAGAGGGAGG TATAAAGAAA ACACAATGAA AACACAAGAT  CTTAGGGGTT CTTCCTTATA TACGTGTGTG TTTTCCTAAA AACTAGGGAA AGTTGGCCAA TGATGCGAGT ATATACCTCG TGACGCGAGG TAAACCGAGT GTCGCCCCTT AGTCTTTCAC  TCAACACTCG TGATGTAGGG CTCATAGCCC ACGAAACAAG GTAGACATTA GAGAACAACT TGCTTAATAG TTGTACCTCA CGATGCTAAG CTCACAACCC GCATTGCGAG ATTGGCAGTA  GCTGACTCAT TGCTTTCTTC ATAGCTTGCT CAATTTCTTC TCACCAGAAT ATACGTAACA ACTATGCCTC AAGTATCATC ATTGATAAAC TTGTAAAAAG CATAACACAA TCACATAGTT  GTCTTGTTCA AGTGGATTTC CAAGGTTTCA AAGCTATTTC CCTACTTTTG TCATTTTATT ACTTTTGAAC TATTTCTTTA CAATAATCAA CTAAAATAAA CATAACTAAC CACTTTAACT  CTTGACTTTA AAAGTGGACT GAAAACCCCT ATAAGATGTC GTTATCATAG GTCCATACTT GAACATTTGT TTGTCTTCAA ACAAACATAC TTGTAAACTA AAATTCACAA AAAAAATAAC  ACACCTCATT GAATAATAAT ATTAGGCTTA ATTACACTTT TGGCTCCCTA TCTTTCTAAA AGTTGCGATT TTGGCCCCCT AACTAATTAA AATACAAAAC AGCCTCATAT GTATTGGATT  TTTGGCAGTT TTGGCCCCCA AGGCCACTTT TGACTTAGTC TTCGCTGACG TGGCACCCAT ATCCCTTAAG TGAGGGTTAC ATCTTATCAA CTATGTTATC TACAATATGA CTTGTTTGAA  ACAATTCAAA AACTAAAAGG ACTTGTTTGG GACTTTTGAA ACTTAAAGAA CCACTTTGGG AAAAACGAAA AACTTAAAGA TCTTTAAATG CATTTGACCA AAAAACTATT TGCATTGAGT  AATGGAATCA TAGAAAAATG TATTCTATCT ATTAAAGGAG AGAAGAGGTA ACCAAAGGAG AGAGGGGTAA TTAAGGAGGA GAAATTTTTT ACCGTCTATA TGTTGTTGTG GTATCTTCGC  TCTACTTGTT GGTATCAATT TCTTCGTAGT TGTTTTAGTA TAAATTTCAA CTGTTATCAT ATTATATTTT GTTGCTGTGT GTTAGTAGGT TCTATAGAAT TTTCTCCAAA TTTTCGCAAG  AAGAAGATTT GTGTGTAGTT TTTTTTTCCT TAGTTTGTGT TTTAGTTGTG TCTATAGAGT CTTCGTTTCA TCTTAGAGAT AAGAAGATTT TTGTGTTGTT AGTATTTATA GCTTAGTATT  ATAGTCACCT TGCATAATGG ATGATTATGG TGTAAATGGT TGGCTACAAC CATTACAACT TGACAGCATC AATTTTAGTT GTTACATCTT AAGTTTAAAG TTTATTATGA TGCACGAAAT  TAGGAGTCCT TAGGATTATA AATATGTTTA CAATCTTAGC ATTTGGTACC ACATTACATA CTAGAAAACT CCTATATTAT TCTTATTATT TCATTAAAGT ATTTTAGTTT TAATTCTTGT  TTTCTTTTAT TTTTCATTAG GTAGCTCATC CTTATGATGA GTGAGTAGTT CCCCTAGAAC ATGGAAAGTA TATGACAAGT TTTCCATAAG TGAAGAATTG GAGTTTAAAT TTTAATAATG  AGAAAAAAGA TGCATATGTT TAGAAGATAA ATAATCCCTT AAAGAGATTA ATCTCACGGT TACTGAATAG AGGGATACCC TAGTTATAAA AAGAAAATGA GGAGATTCTT CATCTTCAAC 
CCAATAACTT CCCAAACAAG TCTTCACTTT CCTGCTTCTA TTCTCTTCTC CTTCACTCCA GCATCATCAT CATCAAGAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCGAGTTGGT TCATATATTT CATTCTGGTT TAGCAAATTT GTTCTCTTCT TATGTAAGTT TCTCACACAC ATTTGAGGGT AGTTTTGGCC ATGTGTTAAA TGTTTACAGA ATTTATAGAT  TTTGATGGTA CTGTGTTAAA TGTCTAATAT TGCAAGGCTG CAATTCCTGA ATAGTCTAGT GTTGCAAGGC TGCAATAAAT ATCAATAAAT CAAAGTGTTC TGTTATGCCT TAATAAAACT  TGGATTCCAA GGTATTGAAG TATATTTTTG TAAGCTCCCT ATTCAACTCT TACAATTAGA GATCTTGGAA TAATTCTATG ATATGATATT GCAAGTCACA ACTGCTTCTG TGATGGTTCC  TCTCCCATCC ATGTAATGTA ACCATAATGT TTAATAAATA CATACTAGTA AGCAGAAGTC CATCATGGAC ACAGTTGCAC GGATATATGG AATCAACTTT CACGTCAAAA TTAATGTCAA  ATGTAGATTC AAATTTAAAC TATAAATGAA AATAAGAAAA CTTGACAGTT GACGCAAGTA ATCAATATAA TAGAAAGAAT GGATATAATT TAGCACCTAA ACTAATAATT GGCTGTAGGT  TGATCTCTTC TCGCATCGGT ATCATGATGA GTATGAATTC CTACGTAGGA TTTGTTCTAA GTGCGGTGTG ATACTCAAAG GACTTAGGGT TATTTAAATA TCCACATTGG TGGTTCTACT  CTTTCAATTT CATCCATCTT ACTTGAAATG ACAGATTGGA AATTAGCAAG TTGTTGGAGA ATCTCATCCA ACTTTTCAGA TTGGGATCCT TTGTAACAAT TGTTATTAGC CATGATGAGT  AAATTATGCG TAAGAGGAAG AATGAAACTA GAAGTTGAAA TTTCTCTTTT TAAAATTGTT TTCCTGCTAT AACCCCCCAA GGAATGAGCC TAATCAAAAT CATAACAGCA TAACAGATAA 
CAATTTTCTT AATATCCGGA GTTGTACTTC TGCACGATGG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGATTCTTCATCTTCAACACATGGATCTTAGTTGCATTCATTGCAGTCCTTCCTGTTCTTCTCTCTCTCAGAACAACTTCATTTAATTTCTATCATACTTCTTTTCGTTCAGTG
AAGTTAGCTGGTATTTTTCCGTTTGATTTCAGTGAAAGTATCAGAGATGGTTCCAATCTTCGATATAATTTCTATAAGGATTCTTGCCCTGAAGCTGAGAATATTGTTCGTTCCGCTGTT
ACCGATATTTACTCTGATCATAGAGACCTTGCACCTTCTCTTCTTCGTCTCTTCTTTCATGATTGCTTCATCCAG
GTTCCTTTTTCTTTAATTTTCTGCTGTTTTCATGTATTTTGCTTT
TCAATCATAAAGACTGCTTGCAATCCAAGATCATGAATTTGATTGGTTATGAAATAGTGAATACCAATAAATATCCTAAATTTTTTGTGTTCTATTTCTTGTTGGTTTTCTTTGCTAAAT
TATCTTCTTGCTTTGATAATGGTATTGATTTTCTGTTGCTGAATCAGGGTTGTGATGCATCCTTGTTGTTGGAGGATAGAAACATTTCCTATGAGAAGCAGGCTATTCCAAATCAAACAT
TAAAAGGTTTTGACAAAGTTGACTTGATTAAGGAGGAGGTGGAACAAGCATGTCCCGGCGTTGTCTCTTGTGCTGACATACTTGCTCTTGCAGCGAGAGATTCCGTTTTTTTG
GTTTGTT
CTTAACATATTTCTTCTCTTAAAAGCTCTCAATCATTCTCATGCATTTTGGAATTTCTAGCCTGCAAATTAAGGGCATGTAAACATTTTCAGTTTTCTTTTTCTAAAACTTCTTTTCATT
TTACATTGTTAACATGGCGATGGAAAACTTGTATAGTGAATAATTTTGATAGAGAGAAAATACAAGGATAGTTAGGGAGAATGGATTTTTAGAAACAATGATAACATTGTCTGATCCCTG
CCTCATTTTGTCCTTAATTATTTTTGCACCTATGATTTATTTATCGACATGGCCATGGCAGGGTGGGGGACCTTTCTATCCAGTTTTAACAGGCAGACGAGATAGCCTGCAATCGTTTTT
CCAGGAGGCAGCTGATCAAATTCCAAGGCCTGACGATAACATCACGCGCACACTGCACCTCTTCAATCTTAGAGGATTCAAAGCACGGGAAACAGTCAGCCTCCTAG
GTAAATTACTTTA
CACTTATGCATTTATGATTATATTATGAAAAAGGTTTGTATCTTGGCCGCATTGCAATCATGTTATTGCGAACTGTTGACAGTTGACCTGATGCGACCTCAACTGTGGTCACAAAGACTT
CAAAAACCATGATGTCGCAGCTGAAATTACGATCACACTTTTTATAAAACCTTGAATATGACTAATGAGATCTGTTGGTTTCTTGATAATCTAAAGGAGAACACAACATTGGAAAAATCG
GTTGCGATTTCATTCAGCAAAGGCTGTACGACTTTCAAGGAACAGGGCAACCAGACCCGAGTATACCTCTCGATTTCCTTAGTCAGATGAGGCAAAACTGTCCTGACAACAATAAGAATA
ATGTCAGCAGCAACGGAATGTTTTCGACGTTTACAGTTTCAAAGCCAATGAATGTTCATCACTCTAATAACAAAGGGATGTCATACAAGCAAGCATTGTCATCTGCAGTGTCATCTGGAG
CATCTTTTGACACTCACTACTATCAGAGATTGTTGAGAGGAAGAGGGTTATTGTTTGCTGATCAACAGCTGATGGCTGAAGAGAAGACAGCCAAATTGGTTTCTGCTTATGCTTCAGATG
ACGGATCAACCTTTCGGATGGATTTCGCAAGGGTTATGATGAAATTGTCTAACCTTGATGTTTTGACTGGAAATCAAGGTCAGGTTCGTCTGAATTGCTCCCGTGTCGTAAGCTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGATTCTTCATCTTCAACACATGGATCTTAGTTGCATTCATTGCAGTCCTTCCTGTTCTTCTCTCTCTCAGAACAACTTCATTTAATTTCTATCATACTTCTTTTCGTTCAGTG
AAGTTAGCTGGTATTTTTCCGTTTGATTTCAGTGAAAGTATCAGAGATGGTTCCAATCTTCGATATAATTTCTATAAGGATTCTTGCCCTGAAGCTGAGAATATTGTTCGTTCCGCTGTT
ACCGATATTTACTCTGATCATAGAGACCTTGCACCTTCTCTTCTTCGTCTCTTCTTTCATGATTGCTTCATCCAG
GGTTGTGATGCATCCTTGTTGTTGGAGGATAGAAACATTTCCTAT
GAGAAGCAGGCTATTCCAAATCAAACATTAAAAGGTTTTGACAAAGTTGACTTGATTAAGGAGGAGGTGGAACAAGCATGTCCCGGCGTTGTCTCTTGTGCTGACATACTTGCTCTTGCA
GCGAGAGATTCCGTTTTTTTG
GGTGGGGGACCTTTCTATCCAGTTTTAACAGGCAGACGAGATAGCCTGCAATCGTTTTTCCAGGAGGCAGCTGATCAAATTCCAAGGCCTGACGATAAC
ATCACGCGCACACTGCACCTCTTCAATCTTAGAGGATTCAAAGCACGGGAAACAGTCAGCCTCCTAG
GAGAACACAACATTGGAAAAATCGGTTGCGATTTCATTCAGCAAAGGCTGTAC
GACTTTCAAGGAACAGGGCAACCAGACCCGAGTATACCTCTCGATTTCCTTAGTCAGATGAGGCAAAACTGTCCTGACAACAATAAGAATAATGTCAGCAGCAACGGAATGTTTTCGACG
TTTACAGTTTCAAAGCCAATGAATGTTCATCACTCTAATAACAAAGGGATGTCATACAAGCAAGCATTGTCATCTGCAGTGTCATCTGGAGCATCTTTTGACACTCACTACTATCAGAGA
TTGTTGAGAGGAAGAGGGTTATTGTTTGCTGATCAACAGCTGATGGCTGAAGAGAAGACAGCCAAATTGGTTTCTGCTTATGCTTCAGATGACGGATCAACCTTTCGGATGGATTTCGCA
AGGGTTATGATGAAATTGTCTAACCTTGATGTTTTGACTGGAAATCAAGGTCAGGTTCGTCTGAATTGCTCCCGTGTCGTAAGCTCTTAA

Retrieve as FASTA