Entry information : CgPGHS01 (CHGG_03459)
Entry ID 4164
Creation 2007-01-31 (Marcel Zamocky)
Last sequence changes 2007-01-31 (Marcel Zamocky)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2012-04-24 (Catherine Mathe (Scipio))
Peroxidase information: CgPGHS01 (CHGG_03459)
Name (synonym) CgPGHS01 (CHGG_03459)
Class H synthase    [Orthogroup: PGHS001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgPGHS01
start..stop
S start..stop
NtetPGHS01_2509 798 0 1..624 5..641
SmaPGHS 796 0 1..624 1..643
NcPGHS01 794 0 24..618 26..635
NdisPGHS01 771 0 9..618 9..632
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4274585..4275171 587 N° 2 4275226..4275528 303 N° 3 4275670..4275956 287 N° 4 4276022..4276096 75
N° 5 4276187..4276809 623  
join(4274585..4275171,4275226..4275528,4275670..4275956,4276022..4276096,4276187 ..4276809)


exon

Literature and cross-references CgPGHS01 (CHGG_03459)
Literature REFERENCE 1 Birren,B., et al., CONSRTM The Broad Institute Genome Sequencing Platform. Annotation of the Chaetomium globosum CBS 148.51 Genome
REFERENCE 2 Zamocky M. et al. (2007) Phylogenetic relationship in the peroxidase - cyclooxygenase superfamily
Protein ref. UniProtKB:   Q2H8J5
DNA ref. JGI genome:   scaffold_2 (4274585..4276809)
Protein sequence: CgPGHS01 (CHGG_03459)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   624
PWM (Da):   %s   69162.78  
PI (pH):   %s   6.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTNGPLNGVHTSGDIKKSSEDEQLVIPPNFKATVIERIGISAFKLLNKVIPWYKLPGVLGAFNLAFLRIELRQYNLHDGYASAEAQGNATDNPLSDARYRGARNSDGKFNSLDQPLMGCKGMRFGRNFPRHLTQKPTEEELWTPNPRHGFSEKVHWPGARGKDESPLQRSTNASLPAWIPSFQIPWTGFQPMCSEEKFNVPAPEGGDSWPHPHMEVFRTKPDDILDPSDIKCPGYKNENTAWWDGSQIYGSSEAVTQALRAKLPNGKLTLDEIGAVSFLPRDKDGNPLTGFHDNCDQIFDKARLVNCALMAKIHTVEWTPAILAHPALEFGMNANWWGVVGEKLTKMLGRISKTSEIISGIPGSGAEQDGVPYSLTEEFVSVYRMHSLIDDIAFHSATTGEHIRTIPVADMTFSKAQLPLRQPTPHRLTFPDAFYTFGTSHPGAITAHNYPSFLRALPTPDGQTRDLGTIDILRDRERGVPRYCAFRRLLRMSVPQTFEELTGGDVDSARELSEAYGGRIELVDALVGSHAEPVIEGFGFSETAFRVFIVMASRRLKSDRFIAGGEGGEWGEGTYTKVGFRWVQDGGMRDVLGRHFPELRETLERGKGKNVFAPWVKVGER

Retrieve as FASTA  
Remarks Complete sequence from genomic. Strain="CBS 148.51". Similarity to bacterial peroxinectins.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGACCAATGGGCCCTTGAATGGTGTTCACACCTCTGGTGATATCAAGAAGTCCAGCGAAGATGAGCAACTAGTAATCCCGCCCAACTTTAAGGCCACCGTGATAGAGCGTATC
GGTATCAGCGCCTTCAAGCTGCTCAACAAAGTTATACCTTGGTACAAGCTTCCCGGTGTTCTCGGTGCTTTTAACCTGGCCTTCCTGAGGATCGAGCTCCGACAATACAATCTGCATGAC
GGCTACGCCTCTGCGGAAGCCCAGGGCAACGCGACGGACAACCCACTGTCGGATGCGCGTTACCGGGGAGCCCGCAACTCCGATGGCAAGTTCAACTCACTCGATCAGCCCCTGATGGGC
TGCAAAGGCATGCGCTTTGGACGCAACTTTCCACGACACCTGACCCAAAAACCGACTGAGGAGGAGTTGTGGACGCCGAATCCACGGCATGGATTCAGCGAGAAGGTTCATTGGCCCGGC
GCGAGGGGGAAGGATGAATCCCCGCTACAACGCTCAACAAATGCTAGCCTGCCGGCTTGGATTCCAAGTTTCCAAATTCCATGGACTGGGTTTCAACCAATGTGCAG
GTGAGTTTATTCT
TGCGCGCCCCCAGTAGATGACGAGACTAATGCGGGTCAGAGCGAGGAGAAGTTCAACGTACCTGCTCCGGAGGGCGGGGACTCGTGGCCCCATCCGCATATGGAGGTGTTCCGAACGAAG
CCAGACGACATCCTGGATCCATCCGATATCAAGTGCCCGGGTTACAAGAACGAGAACACGGCTTGGTGGGATGGATCGCAGATCTATGGCTCGAGCGAGGCCGTTACCCAAGCTCTGCGT
GCCAAGCTGCCAAACGGCAAACTGACGCTTGATGAAATCGGCGCTGTTTCGTTTTTACCGCGAGATAAGGATGGCAATCCCCTTACCGGCTTCCACGATAACTG
GTGGATCGGCATGGAG
ATGTTACACACCCTTTTCGCGCTGGAGCACAATGCGATCTGCGACGCCTTGAAAACGGCATACCCGGATATGACGGGGTAGGTCATCTTCCATCCTTGAGGTGATCTTTGCTAAGATGCC
TCCAGCGACCAGATCTTTGACAAAGCCCGCCTCGTCAACTGTGCCCTGATGGCCAAGATCCACACCGTGGAGTGGACGCCAGCCATCCTCGCGCACCCAGCGCTCGAATTCGGGATGAAC
GCCAACTGGTGGGGCGTTGTGGGCGAGAAGTTGACCAAGATGCTCGGCCGCATATCCAAGACCAGCGAGATCATCAGCGGCATTCCGGGTAGCGGCGCCGAGCAGGACGGGGTTCCGTAC
TCGCTGACGGAGGAGTTTGTTTCCGTGTACAGGATGCACTCGCTGATCCCAG
GTACGGTGTCCTGTTCTTGACCGCCCAACCTACTAAAAGTTCACCGCTGACATGTGCGCATTCAGACG
ACATCGCCTTCCACTCGGCCACCACCGGCGAGCACATCCGGACCATCCCCGTCGCCGACATGACCTTCTCCA
GTAAGTTTTGTATCCCCCTCTCCCCTCCCCCCTCCAACCCACTCTCCC
TCCACAACCACAAAACTAACCACCCCCCTCCTCCCCAAACAGAAGCACAACTCCCCCTCCGCCAACCCACCCCCCACCGCCTCACCTTCCCCGACGCCTTTTACACCTTCGGCACCTCGC
ACCCAGGCGCCATCACCGCGCACAACTACCCCTCCTTCCTGCGCGCGCTGCCCACGCCCGACGGCCAGACGCGCGACCTGGGCACGATCGACATCCTGCGAGACCGCGAGCGCGGCGTGC
CGCGCTACTGCGCCTTCCGCCGCCTGCTGCGCATGTCGGTCCCCCAGACGTTTGAGGAGTTGACGGGCGGGGATGTGGACAGCGCGCGGGAGTTGAGCGAGGCGTATGGGGGGAGGATTG
AGCTAGTGGATGCGTTGGTGGGTTCGCATGCCGAGCCGGTGATTGAGGGGTTTGGGTTTTCGGAGACGGCGTTTAGGGTGTTTATTGTGATGGCGTCGAGAAGGTTGAAGAGTGATCGGT
TTATTGCGGGCGGGGAAGGCGGGGAGTGGGGGGAGGGGACGTATACTAAGGTTGGGTTTAGGTGGGTGCAGGATGGGGGGATGCGGGATGTGTTGGGGAGGCATTTTCCCGAGTTGAGGG
AGACGTTGGAGAGGGGGAAGGGGAAGAATGTCTTTGCGCCGTGGGTGAAGGTGGGAGAGCGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGACCAATGGGCCCTTGAATGGTGTTCACACCTCTGGTGATATCAAGAAGTCCAGCGAAGATGAGCAACTAGTAATCCCGCCCAACTTTAAGGCCACCGTGATAGAGCGTATC
GGTATCAGCGCCTTCAAGCTGCTCAACAAAGTTATACCTTGGTACAAGCTTCCCGGTGTTCTCGGTGCTTTTAACCTGGCCTTCCTGAGGATCGAGCTCCGACAATACAATCTGCATGAC
GGCTACGCCTCTGCGGAAGCCCAGGGCAACGCGACGGACAACCCACTGTCGGATGCGCGTTACCGGGGAGCCCGCAACTCCGATGGCAAGTTCAACTCACTCGATCAGCCCCTGATGGGC
TGCAAAGGCATGCGCTTTGGACGCAACTTTCCACGACACCTGACCCAAAAACCGACTGAGGAGGAGTTGTGGACGCCGAATCCACGGCATGGATTCAGCGAGAAGGTTCATTGGCCCGGC
GCGAGGGGGAAGGATGAATCCCCGCTACAACGCTCAACAAATGCTAGCCTGCCGGCTTGGATTCCAAGTTTCCAAATTCCATGGACTGGGTTTCAACCAATGTGCAG
CGAGGAGAAGTTC
AACGTACCTGCTCCGGAGGGCGGGGACTCGTGGCCCCATCCGCATATGGAGGTGTTCCGAACGAAGCCAGACGACATCCTGGATCCATCCGATATCAAGTGCCCGGGTTACAAGAACGAG
AACACGGCTTGGTGGGATGGATCGCAGATCTATGGCTCGAGCGAGGCCGTTACCCAAGCTCTGCGTGCCAAGCTGCCAAACGGCAAACTGACGCTTGATGAAATCGGCGCTGTTTCGTTT
TTACCGCGAGATAAGGATGGCAATCCCCTTACCGGCTTCCACGATAACTG
CGACCAGATCTTTGACAAAGCCCGCCTCGTCAACTGTGCCCTGATGGCCAAGATCCACACCGTGGAGTGG
ACGCCAGCCATCCTCGCGCACCCAGCGCTCGAATTCGGGATGAACGCCAACTGGTGGGGCGTTGTGGGCGAGAAGTTGACCAAGATGCTCGGCCGCATATCCAAGACCAGCGAGATCATC
AGCGGCATTCCGGGTAGCGGCGCCGAGCAGGACGGGGTTCCGTACTCGCTGACGGAGGAGTTTGTTTCCGTGTACAGGATGCACTCGCTGATCCCAG
ACGACATCGCCTTCCACTCGGCC
ACCACCGGCGAGCACATCCGGACCATCCCCGTCGCCGACATGACCTTCTCCA
AAGCACAACTCCCCCTCCGCCAACCCACCCCCCACCGCCTCACCTTCCCCGACGCCTTTTACACCTTC
GGCACCTCGCACCCAGGCGCCATCACCGCGCACAACTACCCCTCCTTCCTGCGCGCGCTGCCCACGCCCGACGGCCAGACGCGCGACCTGGGCACGATCGACATCCTGCGAGACCGCGAG
CGCGGCGTGCCGCGCTACTGCGCCTTCCGCCGCCTGCTGCGCATGTCGGTCCCCCAGACGTTTGAGGAGTTGACGGGCGGGGATGTGGACAGCGCGCGGGAGTTGAGCGAGGCGTATGGG
GGGAGGATTGAGCTAGTGGATGCGTTGGTGGGTTCGCATGCCGAGCCGGTGATTGAGGGGTTTGGGTTTTCGGAGACGGCGTTTAGGGTGTTTATTGTGATGGCGTCGAGAAGGTTGAAG
AGTGATCGGTTTATTGCGGGCGGGGAAGGCGGGGAGTGGGGGGAGGGGACGTATACTAAGGTTGGGTTTAGGTGGGTGCAGGATGGGGGGATGCGGGATGTGTTGGGGAGGCATTTTCCC
GAGTTGAGGGAGACGTTGGAGAGGGGGAAGGGGAAGAATGTCTTTGCGCCGTGGGTGAAGGTGGGAGAGCGTTGA

Retrieve as FASTA