Entry information : HjHalPrx01
Entry ID 4184
Creation 2007-01-26 (Christophe Dunand)
Last sequence changes 2007-01-26 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: HjHalPrx01
Name HjHalPrx01
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Hypocreaceae Hypocrea
Organism Hypocrea jecorina (Trichoderma reesei)    [TaxId: 51453 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HjHalPrx01
start..stop
S start..stop
AniHalPrx01 117 5e-32 28..230 32..231
AteHalPrx01 115 1e-31 28..230 10..210
PnoHalPrx01 114 1e-30 2..225 1..230
GzHalPrx01 110 3e-29 8..230 1..233
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4390..4550 161 N° 2 4604..5225 622  
join(4390..4550,4604..5225)


exon

Literature and cross-references HjHalPrx01
Literature Diener,S.E., Dunn-Coleman,N., Foreman,P., Houfek,T.D., Teunissen
,P.J.M., van Solingen,P., Dankmeyer,L., Mitchell,T.K., Ward,M. and
Dean,R.A.

Characterization of the protein processing and secretion pathways
in a comprehensive set of expressed sequence tags from Trichoderma
reesei

FEMS Microbiol. Lett. 230 (2), 275-282 (2004)
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=Nucleotide&list_uids=71798392&dopt=GenBank
DNA ref. JGI genome:   scaffold_18 (4390..5225)
Protein sequence: HjHalPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   260 (241)
PWM (Da):   %s   28830.52 (26982.5)  
PI (pH):   %s   5.58 (5.58) Peptide Signal:   %s   cut: 20 range:20-260
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLLGSLLSFTALATAACAARFPKPQIKPWVPPGPDDSRGPCPMINTLANHGYLPHHGRNITASMIEHAFTSFLNVEAGFADAARDFAKAFGHDVFDLVDLNTPGIIQHITSLTRDDYTPEQPQLKADPLRIESLLADSDTPFLTVDSIAKTRLRLLQESEPRVLPDNQVTFTLFEAAMTLTMMADHSPDADHDPPPSAYQGPKDRIRMWFEEERFPTEFGWRPSKRTIKLADMSPAIDAIVKSMEKQDQNGKVALKFHS

Retrieve as FASTA  
Remarks Complete sequence from genomic (29482-30317, 2 exons) and 2 ESTs (CF866308 and CB896268). Strain="QM6a", "QM9414".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCTCTTGGGCTCTCTTCTCTCATTTACGGCCCTTGCTACGGCAGCATGTGCCGCAAGGTTTCCAAAGCCACAAATCAAGCCCTGGGTGCCGCCTGGACCAGATGATTCTCGAGGA
CCGTGTCCTATGATCAACACTCTTGCCAATCATGGTTACCT
GTAAGGACACCGTCAAACCACAGTGTCGAATTGCGTTGCTAACATGCCTCCAGACCTCATCATGGCCGCAACATCACCG
CCTCAATGATTGAGCACGCCTTCACCTCATTCCTCAACGTCGAAGCAGGCTTCGCAGATGCCGCCAGAGACTTTGCCAAAGCTTTTGGCCATGACGTGTTCGACTTAGTCGACCTCAACA
CACCAGGCATAATACAGCATATAACGTCTCTCACGCGGGACGACTACACCCCCGAGCAGCCTCAGCTGAAAGCAGACCCTCTCCGAATAGAGAGTCTCCTCGCTGATAGCGACACTCCCT
TCCTCACAGTCGACTCCATTGCAAAGACACGCTTGCGCCTCCTACAAGAGTCAGAGCCAAGAGTCCTTCCCGACAATCAAGTCACATTCACTCTTTTCGAGGCTGCAATGACGCTTACCA
TGATGGCTGATCACAGTCCCGATGCGGATCATGATCCCCCTCCCTCAGCATACCAAGGTCCCAAGGACCGTATCAGGATGTGGTTTGAGGAAGAGAGGTTTCCCACCGAGTTTGGCTGGA
GACCATCGAAGAGAACGATCAAACTGGCCGATATGAGCCCTGCAATTGACGCGATTGTAAAGTCGATGGAGAAGCAGGATCAGAATGGCAAAGTTGCGCTCAAGTTTCACAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCTCTTGGGCTCTCTTCTCTCATTTACGGCCCTTGCTACGGCAGCATGTGCCGCAAGGTTTCCAAAGCCACAAATCAAGCCCTGGGTGCCGCCTGGACCAGATGATTCTCGAGGA
CCGTGTCCTATGATCAACACTCTTGCCAATCATGGTTACCT
ACCTCATCATGGCCGCAACATCACCGCCTCAATGATTGAGCACGCCTTCACCTCATTCCTCAACGTCGAAGCAGGCTTC
GCAGATGCCGCCAGAGACTTTGCCAAAGCTTTTGGCCATGACGTGTTCGACTTAGTCGACCTCAACACACCAGGCATAATACAGCATATAACGTCTCTCACGCGGGACGACTACACCCCC
GAGCAGCCTCAGCTGAAAGCAGACCCTCTCCGAATAGAGAGTCTCCTCGCTGATAGCGACACTCCCTTCCTCACAGTCGACTCCATTGCAAAGACACGCTTGCGCCTCCTACAAGAGTCA
GAGCCAAGAGTCCTTCCCGACAATCAAGTCACATTCACTCTTTTCGAGGCTGCAATGACGCTTACCATGATGGCTGATCACAGTCCCGATGCGGATCATGATCCCCCTCCCTCAGCATAC
CAAGGTCCCAAGGACCGTATCAGGATGTGGTTTGAGGAAGAGAGGTTTCCCACCGAGTTTGGCTGGAGACCATCGAAGAGAACGATCAAACTGGCCGATATGAGCCCTGCAATTGACGCG
ATTGTAAAGTCGATGGAGAAGCAGGATCAGAATGGCAAAGTTGCGCTCAAGTTTCACAGTTGA

Retrieve as FASTA