Entry information : AniHalPrx01
Entry ID 4185
Creation 2007-01-23 (Filippo Passardi)
Last sequence changes 2007-01-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AniHalPrx01
Name AniHalPrx01
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniHalPrx01
start..stop
S start..stop
GzHalPrx01 386 2e-137 1..262 1..264
AteHalPrx01 373 2e-132 23..264 1..242
PnoHalPrx01 349 2e-122 1..262 1..264
AnHalPrx01 202 5e-65 1..229 1..227
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 114583..114706 124 N° 2 114284..114524 241 N° 3 113944..114215 272 N° 4 113732..113889 158
complement(join(113732..113889,113944..114215,114284..114524,114583..114706))


exon

Literature and cross-references AniHalPrx01
Literature Galagan JE et al. Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae. Nature 438 (7071), 1105-1115 (2005)
Protein ref. UniProtKB:   Q5AZ23
DNA ref. JGI genome:   ChrI_A_nidulans_FGSC_A4 (114706..113732)
Protein sequence: AniHalPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   264 (246)
PWM (Da):   %s   29598.86 (27840.9)  
PI (pH):   %s   5.71 (5.41) Peptide Signal:   %s   cut: 19 range:19-264
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTSVLSAGLSLITSVVAFPHYLDIERRWEPREWIAPGPDDSRGPCPGLNTLANHGYLPRNGKGITLDILKEGMLEGFNIEHGDAVLLFFQAIRTSPIPFSDRFDLADLGRHGILEHDISLSRSDAYFADPKPFNETVWAETMSYFTTSMITVEQLAKARMGRLATSKKTNPEFELSLLADGFSWGECASFFEIMADGTTGTVDKKYIDYWRNERMPTELGWQRRNVTMKGSERIKYSLLLMEAAGVKKRDMTSDAYGLPIVH

Retrieve as FASTA  
Remarks Complete sequence from Genomic (chromo 1). Strain="FGSC4".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACATCAGTTCTATCAGCAGGCCTGAGCCTCATTACCTCGGTAGTAGCGTTTCCGCACTACTTGGACATTGAGCGACGCTGGGAGCCCAGAGAATGGATTGCCCCAGGACCAGAC
GACT
GTAAGCTTCATTTTCGTCATCTACTTTTTTCGGCGACTTGTTGACAGTCAGGCATAAGCCCGCGGTCCGTGTCCGGGTCTAAACACCCTCGCCAATCATGGCTACCTCCCCCGCAA
TGGTAAAGGGATAACGCTGGATATCCTCAAAGAGGGCATGCTTGAGGGGTTCAATATCGAGCATGGCGATGCGGTGCTTTTGTTCTTCCAGGCTATCAGGACCAGTCCAATTCCTTTCTC
GGACAGGTTCGACCTCGCCGACCTCGGCCGGCACGGCATACTGGAACACGATATTAGTTTGAG
GTACGTCTGCCCCGCTCAGTATCTGACCTGGTCGAGATGTATTCTGACGTCAAACTA
CTGCGTATTAGTCGCTCTGATGCATACTTTGCCGACCCCAAACCGTTTAACGAGACCGTTTGGGCCGAGACGATGTCGTACTTTACCACCTCAATGATCACTGTCGAGCAGCTTGCAAAG
GCTCGGATGGGACGCCTGGCTACCTCCAAGAAGACGAACCCTGAGTTCGAGTTGTCCTTGCTTGCCGACGGGTTCAGCTGGGGCGAGTGCGCCTCGTTCTTCGAGATCATGGCGGATGGG
ACGACTGGGACGGTGGACAAGAAATACATTGACTACTGGTTCC
GTACGTGATCCTAATCTATGTGGCCGTTCAGATACTAACCAACCTACCTTTCAGGAAACGAACGCATGCCGACCGAG
CTCGGCTGGCAACGACGCAATGTGACAATGAAGGGCTCTGAGCGGATCAAGTACAGCCTGTTGCTCATGGAAGCTGCCGGCGTGAAGAAGCGAGACATGACATCGGATGCGTATGGTCTG
CCTATCGTCCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACATCAGTTCTATCAGCAGGCCTGAGCCTCATTACCTCGGTAGTAGCGTTTCCGCACTACTTGGACATTGAGCGACGCTGGGAGCCCAGAGAATGGATTGCCCCAGGACCAGAC
GACT
CCCGCGGTCCGTGTCCGGGTCTAAACACCCTCGCCAATCATGGCTACCTCCCCCGCAATGGTAAAGGGATAACGCTGGATATCCTCAAAGAGGGCATGCTTGAGGGGTTCAATATC
GAGCATGGCGATGCGGTGCTTTTGTTCTTCCAGGCTATCAGGACCAGTCCAATTCCTTTCTCGGACAGGTTCGACCTCGCCGACCTCGGCCGGCACGGCATACTGGAACACGATATTAGT
TTGAG
TCGCTCTGATGCATACTTTGCCGACCCCAAACCGTTTAACGAGACCGTTTGGGCCGAGACGATGTCGTACTTTACCACCTCAATGATCACTGTCGAGCAGCTTGCAAAGGCTCGG
ATGGGACGCCTGGCTACCTCCAAGAAGACGAACCCTGAGTTCGAGTTGTCCTTGCTTGCCGACGGGTTCAGCTGGGGCGAGTGCGCCTCGTTCTTCGAGATCATGGCGGATGGGACGACT
GGGACGGTGGACAAGAAATACATTGACTACTGGTTCC
GAAACGAACGCATGCCGACCGAGCTCGGCTGGCAACGACGCAATGTGACAATGAAGGGCTCTGAGCGGATCAAGTACAGCCTG
TTGCTCATGGAAGCTGCCGGCGTGAAGAAGCGAGACATGACATCGGATGCGTATGGTCTGCCTATCGTCCACTGA

Retrieve as FASTA