Entry information : CgHalPrx01 (CgHTPx1)
Entry ID 4189
Creation 2007-01-24 (Filippo Passardi)
Last sequence changes 2007-01-24 (Filippo Passardi)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2012-10-24 (Marcel Zamocky)
Peroxidase information: CgHalPrx01 (CgHTPx1)
Name (synonym) CgHalPrx01 (CgHTPx1)
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgHalPrx01
start..stop
S start..stop
AorHalPrx02 321 9e-112 8..242 3..240
AteHalPrx02 320 6e-111 1..267 1..263
AniHalPrx02 309 8e-107 1..268 1..267
PnoHalPrx03 279 6e-95 1..269 1..267
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 383014..383113 100 N° 2 382763..382955 193 N° 3 382346..382665 320 N° 4 382056..382258 203
complement(join(382056..382258,382346..382665,382763..382955,383014..383113))


exon

Literature and cross-references CgHalPrx01 (CgHTPx1)
Literature Birren B. et al. Annotation of the Chaetomium globosum CBS 148.51 Genome.
Protein ref. UniProtKB:   Q2GU92
DNA ref. JGI genome:   scaffold_6 (383113..382056)
Protein sequence: CgHalPrx01 (CgHTPx1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   271 (249)
PWM (Da):   %s   29857.89 (27663.8)  
PI (pH):   %s   6.6 (6.60) Peptide Signal:   %s   cut: 23 range:23-271
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSPTALLGCLSLACLMSEASSIPAWHPPGPGDLRGPCPMMNTLANHGILPHDGRAITKEAVIKAMKQGLNFDSTLAVVMFDQAVVANPEPNATFFTLDHLNRHNVLEHDASLSRTDAFFGSNHIFNQTIFDQTRRYWPEPVITTAHMANAKIARQIESKAFNPEYRFTESVENFSLGEMAAPFIAFGDLEEATVNRTLVEYFQNERLPTELGWNVREEVVAVEAILRISNMIGKATSLITNQDSDGSAGSNCTKRGLRRGFHAAVRRDL

Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 introns). strain="CBS 148.51".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATCACCCACCGCCCTCCTCGGCTGCTTGTCCCTCGCCTGCCTTATGTCCGAGGCGTCTAGTATCCCCGCATGGCACCCCCCTGGCCCCGGTGACCGTGAGCATTCCTTGTCCATT
AAGCTGTCCATAAATCCTTTACTGATGTTGTGCCTCAGTCCGCGGCCCCTGTCCGATGATGAACACGCTCGCCAACCACGGGATCCTACCCCATGATGGCAGGGCCATCACTAAAGAAGC
CGTCATCAAAGCCATGAAGCAGGGGCTGAATTTCGATTCGACTCTTGCTGTCGTCATGTTCGACCAGGCTGTTGTCGCCAACCCCGAACCCAATGCCACCTTCTTCACTCT
GTACGTCTC
AGTGCTCCATCATGTCCTGGCGTTTACTTTTCAATGCTCCATGGAACCCTAGATGCTTTTGCTGACATGATGATCTGCCCCGATACAGAGACCACCTCAACCGCCACAATGTCCTCGAGC
ACGACGCCAGCCTGAGCCGCACCGACGCCTTCTTCGGGAGCAACCACATCTTTAATCAGACCATTTTCGACCAAACCCGCCGCTACTGGCCCGAGCCCGTCATCACCACGGCCCACATGG
CCAACGCCAAGATTGCCCGCCAAATTGAGTCTAAGGCGTTCAACCCCGAGTATCGCTTCACTGAGTCCGTGGAGAACTTCAGCCTCGGCGAGATGGCGGCCCCCTTTATTGCGTTTGGAG
ATCTTGAAGAGGCCACTGTGAATAGGACGTTGGTCGAATACTTTTTCC
GTGAGTAGAATCGATCTAGCAATACCAAGTTCCGGCCCCTTCAAAGGTTCGTACAGATAGCAGCTATTAACC
GCCCTGCTACATTAGAAAACGAACGTCTGCCGACGGAGTTGGGTTGGAATGTCAGGGAAGAAGTCGTCGCAGTGGAGGCTATTCTCAGAATATCGAATATGATTGGAAAGGCGACGAGTT
TAATCACGAATCAGGATTCGGACGGAAGTGCTGGTAGCAACTGTACGAAAAGAGGACTGCGCAGGGGATTCCACGCCGCAGTCCGGCGGGACTTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATCACCCACCGCCCTCCTCGGCTGCTTGTCCCTCGCCTGCCTTATGTCCGAGGCGTCTAGTATCCCCGCATGGCACCCCCCTGGCCCCGGTGACCTCCGCGGCCCCTGTCCGATG
ATGAACACGCTCGCCAACCACGGGATCCTACCCCATGATGGCAGGGCCATCACTAAAGAAGCCGTCATCAAAGCCATGAAGCAGGGGCTGAATTTCGATTCGACTCTTGCTGTCGTCATG
TTCGACCAGGCTGTTGTCGCCAACCCCGAACCCAATGCCACCTTCTTCACTCT
AGACCACCTCAACCGCCACAATGTCCTCGAGCACGACGCCAGCCTGAGCCGCACCGACGCCTTCTTC
GGGAGCAACCACATCTTTAATCAGACCATTTTCGACCAAACCCGCCGCTACTGGCCCGAGCCCGTCATCACCACGGCCCACATGGCCAACGCCAAGATTGCCCGCCAAATTGAGTCTAAG
GCGTTCAACCCCGAGTATCGCTTCACTGAGTCCGTGGAGAACTTCAGCCTCGGCGAGATGGCGGCCCCCTTTATTGCGTTTGGAGATCTTGAAGAGGCCACTGTGAATAGGACGTTGGTC
GAATACTTTTTCC
AAAACGAACGTCTGCCGACGGAGTTGGGTTGGAATGTCAGGGAAGAAGTCGTCGCAGTGGAGGCTATTCTCAGAATATCGAATATGATTGGAAAGGCGACGAGTTTA
ATCACGAATCAGGATTCGGACGGAAGTGCTGGTAGCAACTGTACGAAAAGAGGACTGCGCAGGGGATTCCACGCCGCAGTCCGGCGGGACTTGTAG

Retrieve as FASTA