Entry information : CgHalPrx02 (SNOG_14625)
Entry ID 4193
Creation 2007-01-24 (Filippo Passardi)
Last sequence changes 2007-01-24 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-24 (Catherine Mathe (Scipio))
Peroxidase information: CgHalPrx02 (SNOG_14625)
Name (synonym) CgHalPrx02 (SNOG_14625)
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation N/D
Tissue types Antheridias
Anthers
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgHalPrx02
start..stop
S start..stop
CgHalPrx03 371 9e-132 1..260 1..251
AnHalPrx01 264 4e-89 1..238 1..246
TterHalPrx01 263 9e-89 25..232 41..249
AorHalPrx01 230 2e-76 22..230 22..229
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2175654..2175741 88 N° 2 2175354..2175594 241 N° 3 2175017..2175288 272 N° 4 2174776..2174957 182
complement(join(2174776..2174957,2175017..2175288,2175354..2175594,2175654..2175 741))


exon

Literature and cross-references CgHalPrx02 (SNOG_14625)
Literature Birren, B. et al. Annotation of the Chaetomium globosum CBS 148.51 Genome
Unpublished (2004)
Protein ref. GenPept:   88178817 UniProtKB:   Q2GWW6 [Incorrect prediction]
DNA ref. JGI genome:   scaffold_5 (2175741..2174776)
Protein sequence: CgHalPrx02 (SNOG_14625)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   260 (243)
PWM (Da):   %s   28840.07 (26975.0)  
PI (pH):   %s   5.53 (5.28) Peptide Signal:   %s   cut: 18 range:18-260
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTLFLLTLAAFTPVFAGFDTWAPPGPYDVRAPCPMLNTLANHGFLPHDGHEITREQTENALFDALHIDKMLGSSLFDFAMTTNPVANSTTFSLNDLGNHNVLEHDASLSRSDAYFGNTLTFNQTVFDETKSYWTDETVTIEMASNARLARIKTSNATNPTYSMSELGNGFTKGESAAYVVIFGDKISGTVPRAWVEWLEHEQLPQHLGWKRPTELFRDGDLDKYMDAMQNVIVGETPGCPAGKQQQRKGRRTPSHFGW

Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 introns). Probably wrongly predicted in NCBI/Swissprot (3' end). Correctly annotated by the PeroxiBase using Softberry (Magnaporthe: same class as Chaetomium). No EST. Strain="CBS 148.51".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACCTTGTTTCTCCTTACCCTTGCGGCATTTACCCCGGTGTTTGCGGGATTCGACACCTGGGCACCCCCTGGACCATATGATGGTAACGACGAACAGAGGGAGCATCACAAAGAC
GTTACTAATCAGTACCCTTACACGCAGTGCGAGCCCCGTGCCCCATGCTCAACACTCTTGCGAATCACGGCTTTCTCCCCCACGACGGCCACGAGATCACCAGGGAACAGACCGAAAACG
CGCTGTTCGATGCCCTTCATATTGACAAGATGCTGGGTAGCTCCCTCTTTGACTTCGCCATGACCACAAACCCAGTCGCCAACTCGACGACATTCTCCCTGAACGACCTCGGCAACCATA
ACGTGCTTGAGCACGACGCAAGCCTAAG
GTATGATTGCGGCACCAACTCCCTCACACTCACGGTCCGGCCCCCGTACTAATGCTGGTGTGTAGCCGGTCGGATGCTTACTTCGGCAACAC
GCTCACGTTCAACCAAACCGTTTTCGACGAGACCAAGTCATACTGGACAGACGAGACCGTCACCATCGAGATGGCCTCGAATGCCAGGCTGGCCCGCATCAAGACCTCGAATGCGACGAA
CCCGACGTATTCCATGTCGGAGCTGGGCAATGGCTTTACCAAGGGAGAATCGGCCGCCTACGTCGTTATATTTGGCGACAAGATCTCTGGCACAGTTCCGAGGGCTTGGGTTGAGTGGTT
GTTCG
GTGAGTATCGCCGAGTTAGTGAGAAAAGCGAAAAGCGAAACTAACGAACCTCTGAAAAGAGCACGAACAGCTGCCTCAACACCTTGGTTGGAAGAGGCCGACCGAGTTGTTTCGG
GACGGTGACCTGGACAAATACATGGACGCGATGCAAAATGTTATAGTCGGTGAGACCCCTGGATGCCCGGCAGGCAAACAGCAGCAGCGCAAGGGTCGCCGCACACCTTCCCACTTTGGC
TGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACCTTGTTTCTCCTTACCCTTGCGGCATTTACCCCGGTGTTTGCGGGATTCGACACCTGGGCACCCCCTGGACCATATGATGTGCGAGCCCCGTGCCCCATGCTCAACACTCTT
GCGAATCACGGCTTTCTCCCCCACGACGGCCACGAGATCACCAGGGAACAGACCGAAAACGCGCTGTTCGATGCCCTTCATATTGACAAGATGCTGGGTAGCTCCCTCTTTGACTTCGCC
ATGACCACAAACCCAGTCGCCAACTCGACGACATTCTCCCTGAACGACCTCGGCAACCATAACGTGCTTGAGCACGACGCAAGCCTAAG
CCGGTCGGATGCTTACTTCGGCAACACGCTC
ACGTTCAACCAAACCGTTTTCGACGAGACCAAGTCATACTGGACAGACGAGACCGTCACCATCGAGATGGCCTCGAATGCCAGGCTGGCCCGCATCAAGACCTCGAATGCGACGAACCCG
ACGTATTCCATGTCGGAGCTGGGCAATGGCTTTACCAAGGGAGAATCGGCCGCCTACGTCGTTATATTTGGCGACAAGATCTCTGGCACAGTTCCGAGGGCTTGGGTTGAGTGGTTGTTC
G
AGCACGAACAGCTGCCTCAACACCTTGGTTGGAAGAGGCCGACCGAGTTGTTTCGGGACGGTGACCTGGACAAATACATGGACGCGATGCAAAATGTTATAGTCGGTGAGACCCCTGGA
TGCCCGGCAGGCAAACAGCAGCAGCGCAAGGGTCGCCGCACACCTTCCCACTTTGGCTGGTAA

Retrieve as FASTA