Entry information : AniHalPrx03
Entry ID 4195
Creation 2007-01-23 (Filippo Passardi)
Last sequence changes 2007-01-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AniHalPrx03
Name AniHalPrx03
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniHalPrx03
start..stop
S start..stop
AorHalPrx02 267 2e-90 39..270 14..244
CgHalPrx01 246 4e-82 46..268 25..244
AteHalPrx02 241 5e-80 47..266 30..246
AniHalPrx02 238 1e-78 32..266 13..244
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4414571..4414733 163 N° 2 4414776..4415025 250 N° 3 4415130..4415532 403  
join(4414571..4414733,4414776..4415025,4415130..4415532)


exon

Literature and cross-references AniHalPrx03
Literature Galagan, J.E. et al.

Sequencing of Aspergillus nidulans and comparative analysis with A.
fumigatus and A. oryzae

Nature 438 (7071), 1105-1115 (2005)
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=29570896&itemID=160&view=gbwithparts
Protein ref. GenPept:   40745527 UniProtKB:   Q5BA52
DNA ref. JGI genome:   ChrVII_A_nidulans_FGSC_A4 (4414571..4415532)
Protein sequence: AniHalPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   271 (254)
PWM (Da):   %s   29479.49 (27856.6)  
PI (pH):   %s   5.27 (5.10) Peptide Signal:   %s   cut: 18 range:18-271
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLTAPSLLALAGVVSATLHLDLNLGGSHPHVHASNSKLGAENPHAWIAAGDGDGYLRAARSPCPMMNTLANHGYIHRDGRNITREGLANGLVDSINFSQELAESMFDNVLAMDPTATNFDLDSLNAHNVGEHDASLSRADAYFGNNHVFNPNVFAQTRAYWTHPTVTAAMLANSKIARQLHSKAFNPAYTYTEKTEQTSYTETGFPILAFGDIEAGTVNRDFVEYWFENERLPSEVGWTVREEPVTPEQLAAVTQMIAEAVKLVTGEKKQ

Retrieve as FASTA  
Remarks Complete sequence from Genomic. 3 exons. Strain="FGSC4".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCACTGCACCGTCGCTCCTTGCCCTAGCCGGCGTCGTCTCCGCCACCCTCCATCTAGACCTGAACCTGGGCGGATCGCACCCACACGTTCATGCTTCCAACTCCAAACTCGGT
GCCGAGAACCCGCATGCTTGGATTGCTGCTGGGGATGGAGACG
GTACGTCTTCACGGGACCACGGCCCTACGAGATGCTAACCAGGGTATCTTCGTGCAGCCCGCAGTCCCTGCCCGATG
ATGAACACCCTTGCCAACCACGGCTATATCCACCGAGACGGGCGTAACATCACACGCGAGGGCCTGGCCAATGGACTGGTTGACTCAATCAACTTCTCCCAAGAATTGGCCGAGAGCATG
TTTGACAATGTCCTGGCCATGGACCCAACCGCCACAAACTTTGATCTAGACTCCCTGAATGCGCACAACGTCGGCGAGCATGATGCCTCTCTCAG
GTAAGCTATGTTTTCAATTTTTTTC
TAATTTTTTTATCCTTTTTTATCCTTTCCCCACCGCATTCCCAGGCTGCACGAAATCAGGACTAACCATTGTCTGTCAGCCGCGCGGATGCCTACTTCGGCAACAACCACGTCTTTAATC
CCAACGTATTCGCCCAAACACGCGCCTACTGGACGCACCCTACAGTGACCGCCGCCATGCTTGCAAATAGCAAGATCGCACGGCAGCTGCACAGCAAAGCATTCAACCCTGCCTACACGT
ACACAGAGAAAACCGAGCAGACGAGCTACACGGAGACCGGTTTCCCGATCCTGGCCTTTGGCGATATCGAGGCCGGCACGGTGAACCGTGACTTCGTGGAGTACTGGTTTGAAAATGAGC
GGTTGCCATCAGAGGTCGGATGGACTGTGCGTGAGGAGCCGGTGACGCCGGAGCAGCTGGCAGCCGTGACGCAGATGATCGCGGAGGCCGTCAAGTTGGTGACGGGGGAGAAGAAGCAGT
AA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCACTGCACCGTCGCTCCTTGCCCTAGCCGGCGTCGTCTCCGCCACCCTCCATCTAGACCTGAACCTGGGCGGATCGCACCCACACGTTCATGCTTCCAACTCCAAACTCGGT
GCCGAGAACCCGCATGCTTGGATTGCTGCTGGGGATGGAGACG
GGTATCTTCGTGCAGCCCGCAGTCCCTGCCCGATGATGAACACCCTTGCCAACCACGGCTATATCCACCGAGACGGG
CGTAACATCACACGCGAGGGCCTGGCCAATGGACTGGTTGACTCAATCAACTTCTCCCAAGAATTGGCCGAGAGCATGTTTGACAATGTCCTGGCCATGGACCCAACCGCCACAAACTTT
GATCTAGACTCCCTGAATGCGCACAACGTCGGCGAGCATGATGCCTCTCTCAG
CCGCGCGGATGCCTACTTCGGCAACAACCACGTCTTTAATCCCAACGTATTCGCCCAAACACGCGCC
TACTGGACGCACCCTACAGTGACCGCCGCCATGCTTGCAAATAGCAAGATCGCACGGCAGCTGCACAGCAAAGCATTCAACCCTGCCTACACGTACACAGAGAAAACCGAGCAGACGAGC
TACACGGAGACCGGTTTCCCGATCCTGGCCTTTGGCGATATCGAGGCCGGCACGGTGAACCGTGACTTCGTGGAGTACTGGTTTGAAAATGAGCGGTTGCCATCAGAGGTCGGATGGACT
GTGCGTGAGGAGCCGGTGACGCCGGAGCAGCTGGCAGCCGTGACGCAGATGATCGCGGAGGCCGTCAAGTTGGTGACGGGGGAGAAGAAGCAGTAA

Retrieve as FASTA