Entry information : CgHalPrx03 (CgHTP3)
Entry ID 4198
Creation 2007-01-24 (Filippo Passardi)
Last sequence changes 2007-01-24 (Filippo Passardi)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2015-03-04 (Marcel Zamocky)
Peroxidase information: CgHalPrx03 (CgHTP3)
Name (synonym) CgHalPrx03 (CgHTP3)
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgHalPrx03
start..stop
S start..stop
CgHalPrx02 371 9e-132 1..251 1..260
AnHalPrx01 239 2e-79 1..250 1..261
TterHalPrx01 231 3e-76 25..226 41..251
AorHalPrx02 214 9e-70 1..242 1..251
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 970907..970994 88 N° 2 971059..971299 241 N° 3 971372..971619 248 N° 4 971715..971893 179
join(970907..970994,971059..971299,971372..971619,971715..971893)


exon

Literature and cross-references CgHalPrx03 (CgHTP3)
Literature Birren B et al.

Annotation of the Chaetomium globosum CBS 148.51 Genome

Unpublished (2004)
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=CH408029
Protein ref. GenPept:   88184616 UniProtKB:   Q2HHI5
DNA ref. JGI genome:   scaffold_1 (970907..971893)
Protein sequence: CgHalPrx03 (CgHTP3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251 (234)
PWM (Da):   %s   28229.85 (26538.9)  
PI (pH):   %s   4.97 (4.85) Peptide Signal:   %s   cut: 18 range:18-251
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTSLLPALAAVSPVLAGFDTWAPPGPYDVRGPCPMLNTLTNHGFFPHDGQDIDRETTENALFDALHVNKTLASFLFDFALTTNPIANSTTFSLNDLGNHNVLEHDASLSVLAFNHTIFEETKSYWTDETVTLKMAADARYYRIKSSQATNPTYQMSELGDAFTYGESAAYVVLFGDKESQTVPRSWVEWLEKEQLPQHLGWKRPATSFELNDLDKFMALIQNYTQEIEEPSCESRKQRRKPRGPSHFGF

Retrieve as FASTA  
Remarks Complete sequence from Genomic. Strain="CBS 148.51". 4 exons. Uncorrect prediction in NCBI/SwissProt. Corrected by the PeroxiBase Team with Softberry (large gap was missing), under the Magnaporthe (same fungal class) option.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACCTCCCTGCTTCCGGCTCTTGCTGCTGTCAGCCCTGTGCTGGCGGGGTTCGACACCTGGGCGCCCCCGGGACCGTATGATGGTAAAGCCCACCAGATCATAGAGGCAAGACTA
CAAACGGAAAACTAACTGCTATCCGCGCATAGTGCGAGGCCCATGTCCCATGCTTAACACCCTGACCAACCACGGTTTCTTCCCTCACGATGGCCAAGACATCGACCGGGAGACCACCGA
GAACGCCCTGTTCGACGCTCTCCACGTCAACAAGACCTTGGCCAGCTTCCTGTTTGATTTTGCCCTGACCACCAACCCGATCGCCAACTCGACCACCTTCTCCCTAAACGATCTCGGAAA
CCACAACGTTCTCGAGCACGACGCCAGTCTTAG
GTATGGCAATTGATAATGTATTCTGGAGCCATTTCTAACCACGTGCAGCCGCGCGGATGCCTACCACGGAAGCGTCCTCGCCTTCAA
CCACACCATCTTCGAGGAGACCAAGTCCTACTGGACCGATGAGACCGTCACCCTCAAGATGGCCGCCGATGCGAGATATTATCGCATCAAGTCTTCGCAAGCCACCAACCCGACCTACCA
AATGTCGGAACTCGGCGATGCCTTCACCTACGGCGAGTCGGCTGCCTATGTTGTGCTCTTCGGCGACAAGGAGTCCCAGACTGTCCCCAGGAGCTGGGTTGAATGGCTCTTTG
GTGAGTC
CCCCTTTTTTTCTGCCGCAACACCAACCAAAACTGTTTATCAGCGCTCGATAAAATGAATTGAAGCTAACGGTTCGCGTGTTTTACAGAGAAGGAGCAACTCCCTCAGCACCTTGGGTGG
AAGCGTCCGGCCACGTCGTTTGAGTTGAACGATCTGGACAAGTTCATGGCCCTGATCCAAAACTACACCCAGGAGATCGAGGAACCTTCCTGCGAGTCTCGGAAGCAGCGCCGCAAGCCC
CGCGGCCCTTCTCACTTTGGCTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACCTCCCTGCTTCCGGCTCTTGCTGCTGTCAGCCCTGTGCTGGCGGGGTTCGACACCTGGGCGCCCCCGGGACCGTATGATGTGCGAGGCCCATGTCCCATGCTTAACACCCTG
ACCAACCACGGTTTCTTCCCTCACGATGGCCAAGACATCGACCGGGAGACCACCGAGAACGCCCTGTTCGACGCTCTCCACGTCAACAAGACCTTGGCCAGCTTCCTGTTTGATTTTGCC
CTGACCACCAACCCGATCGCCAACTCGACCACCTTCTCCCTAAACGATCTCGGAAACCACAACGTTCTCGAGCACGACGCCAGTCTTAG
CGTCCTCGCCTTCAACCACACCATCTTCGAG
GAGACCAAGTCCTACTGGACCGATGAGACCGTCACCCTCAAGATGGCCGCCGATGCGAGATATTATCGCATCAAGTCTTCGCAAGCCACCAACCCGACCTACCAAATGTCGGAACTCGGC
GATGCCTTCACCTACGGCGAGTCGGCTGCCTATGTTGTGCTCTTCGGCGACAAGGAGTCCCAGACTGTCCCCAGGAGCTGGGTTGAATGGCTCTTTG
AGAAGGAGCAACTCCCTCAGCAC
CTTGGGTGGAAGCGTCCGGCCACGTCGTTTGAGTTGAACGATCTGGACAAGTTCATGGCCCTGATCCAAAACTACACCCAGGAGATCGAGGAACCTTCCTGCGAGTCTCGGAAGCAGCGC
CGCAAGCCCCGCGGCCCTTCTCACTTTGGCTTCTAA

Retrieve as FASTA