Entry information : GzHalPrx02
Entry ID 4200
Creation 2007-01-26 (Filippo Passardi)
Last sequence changes 2007-01-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: GzHalPrx02
Name GzHalPrx02
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GzHalPrx02
start..stop
S start..stop
PangHalPrx04 207 4e-68 25..201 41..221
MgrHalPrx01 191 2e-61 10..201 32..221
NcHalPrx01 164 6e-51 25..201 46..233
AnHalPrx01 134 2e-39 25..201 30..209
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3630522..3630618 97 N° 2 3630264..3630470 207 N° 3 3629917..3630213 297 N° 4 3629870..3629886 17
complement(join(3629870..3629886,3629917..3630213,3630264..3630470,3630522..3630 618))


exon

Literature and cross-references GzHalPrx02
Literature Birren B. et al.

Fusarium graminearum genome sequence

Unpublished
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=30475031&itemID=45&view=gbwithparts
Protein ref. GenPept:   42548263 UniProtKB_Uniparc:   Q4IH72
DNA ref. JGI genome:   Supercontig_3.2 (3630618..3629870)
Protein sequence: GzHalPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   205 (191)
PWM (Da):   %s   22618.13 (21082.3)  
PI (pH):   %s   4.75 (4.75) Peptide Signal:   %s   cut: 20 range:15-205
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLFNLLFLCSAVLAHHHSADDSNEWHGPSKWDRRSPCPMVNSLANHGYLPRDGLNITLDDLIEGFTDAINLDPAATTLVGKKALDTGDGTSFNLDDLAKPGILEHDGSLSRDDIYFGDNSRLDPHIWKSTLQHFRAPYISIQEAADARKDRLQVAAANNPEFSMTAEQNKISLIETSLYLTVFGNPEEGNANTHWVRTLFDANVM

Retrieve as FASTA  
Remarks Complete sequence from Genomic (Chromo II). Strain="PH-1", "NRRL 31084". 4 exons".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTTCAACCTACTTTTTCTTTGCTCCGCTGTTTTGGCTCACCATCACTCAGCTGATGACTCAAATGAGTGGCACGGCCCTTCTAAATGGGATCGTAGGTATATCTTGCCTATCATC
AATCGGACACGAAACTAAAAGATTGCAGGCCGAAGCCCTTGTCCCATGGTCAACTCCCTCGCTAACCATGGGTACCTCCCTCGTGACGGCCTCAACATCACACTTGATGACTTGATCGAG
GGCTTCACCGACGCCATTAACCTGGACCCAGCCGCCACAACCCTCGTTGGCAAGAAGGCGTTGGATACAGGCGATGGTACCTCCTTCAACCTTGACGACTTGGCCAAGCCTGGTA
GTAAG
TAATCCAAATTCGGACTCTTGAAAGTCTTTAACCAAACGAACTAGTTCTTGAGCATGACGGAAGCTTGAGCCGTGACGACATTTACTTTGGTGACAACTCGAGGTTGGACCCTCACATCT
GGAAGTCAACCTTACAGCACTTTCGTGCGCCCTACATCTCCATCCAGGAGGCCGCTGATGCCCGCAAGGATCGTCTTCAGGTTGCTGCCGCTAACAACCCGGAGTTTTCTATGACTGCTG
AGCAGAACAAGATCAGCTTGATCGAGACTTCTCTGTACTTGACTGTTTTTGGCAACCCCGAAGAGGGAAATGCGAATACTCATTGGGTCAGGACACTCTTTG
GTAAGTCACTCATGCTTT
ACGGATGTGCAGATGCTAATGTCATGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTTCAACCTACTTTTTCTTTGCTCCGCTGTTTTGGCTCACCATCACTCAGCTGATGACTCAAATGAGTGGCACGGCCCTTCTAAATGGGATCGCCGAAGCCCTTGTCCCATGGTC
AACTCCCTCGCTAACCATGGGTACCTCCCTCGTGACGGCCTCAACATCACACTTGATGACTTGATCGAGGGCTTCACCGACGCCATTAACCTGGACCCAGCCGCCACAACCCTCGTTGGC
AAGAAGGCGTTGGATACAGGCGATGGTACCTCCTTCAACCTTGACGACTTGGCCAAGCCTGGTA
TTCTTGAGCATGACGGAAGCTTGAGCCGTGACGACATTTACTTTGGTGACAACTCG
AGGTTGGACCCTCACATCTGGAAGTCAACCTTACAGCACTTTCGTGCGCCCTACATCTCCATCCAGGAGGCCGCTGATGCCCGCAAGGATCGTCTTCAGGTTGCTGCCGCTAACAACCCG
GAGTTTTCTATGACTGCTGAGCAGAACAAGATCAGCTTGATCGAGACTTCTCTGTACTTGACTGTTTTTGGCAACCCCGAAGAGGGAAATGCGAATACTCATTGGGTCAGGACACTCTTT
G
ATGCTAATGTCATGTAG

Retrieve as FASTA