Entry information : PnoHalPrx04
Entry ID 4203
Creation 2007-01-29 (Filippo Passardi)
Last sequence changes 2007-01-29 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PnoHalPrx04
Name PnoHalPrx04
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PnoHalPrx04
start..stop
S start..stop
AniHalPrx04 201 5e-64 4..238 17..249
PanHalPrx03 198 3e-63 7..239 6..244
PnoHalPrx05 183 5e-57 6..251 30..277
AniHalPrx04_FGSC26 172 1e-52 4..212 17..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2180932..2181538 607 N° 2 2180677..2180876 200  
complement(join(2180677..2180876,2180932..2181538))


exon

Literature and cross-references PnoHalPrx04
Literature Birren et al.

Annotation of the Phaeosphaeria nodorum SN15 genome

unpubslihed
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=Nucleotide&list_uids=62183501&dopt=GenBank
Protein ref. GenPept:   111071365 UniProtKB:   Q0V4S4
DNA ref. JGI genome:   scaffold_1 (2181538..2180677)
Protein sequence: PnoHalPrx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   268 (252)
PWM (Da):   %s   29267.61 (27499.6)  
PI (pH):   %s   6.51 (6.24) Peptide Signal:   %s   cut: 17 range:17-268
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLFFLLSALIAFVCADANFADWHPQGDGEVRSPCPALNSLANHGILPRDGHNLTVPILVKAMGEGLNVSPEVATSLSNLGMTLSKNTASGAFNLDDLNKHNAIEHDGSLSRKDIDLGGNEKLDADTFKQTLGFYKGASNIGLDEVAAARWGRVQNSKTRNSKVQYGDAQRFPSYFESSAYYQLFKDPNSSKARVDWIKVFFQEERMPVNEGWKPVNHIDGFSVAQVILQLVMRTPEKVTDATSPSDNFCIAGFCGLSPGGFFKSFRA

Retrieve as FASTA  
Remarks Complete sequence from Genomic. Strain="SN15". 2 exons.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTTCTTCCTCCTCAGCGCGCTGATTGCGTTTGTCTGCGCCGATGCCAACTTCGCAGACTGGCACCCGCAAGGCGACGGCGAAGTGCGCTCGCCCTGCCCAGCGCTCAACTCC
CTCGCCAACCACGGCATCCTCCCACGAGACGGGCACAACCTCACTGTACCCATCCTCGTCAAAGCCATGGGCGAAGGCCTCAACGTCTCCCCCGAAGTTGCCACCTCCCTGTCCAACCTC
GGCATGACTCTGTCCAAAAACACAGCCAGCGGCGCTTTCAACCTCGACGACTTGAACAAGCACAACGCCATTGAGCACGACGGCAGCCTCAGCAGGAAGGACATTGACCTCGGCGGCAAC
GAGAAGTTAGATGCCGATACGTTCAAGCAGACGCTGGGCTTCTACAAGGGCGCGAGCAACATTGGACTTGACGAAGTGGCTGCGGCCCGCTGGGGTCGTGTGCAGAACTCCAAGACGAGG
AACTCCAAGGTCCAGTATGGCGATGCGCAGCGGTTTCCGTCGTACTTTGAGTCTTCGGCGTATTATCAGCTGTTCAAGGATCCGAACTCGAGCAAGGCTAGGGTGGATTGGATCAAGGTC
TTTTTCC
GTAAGTTTCTTTACCATGTGATCTTGGGCTGGATCAGAGCTAACTGTTGCGTCAGAGGAGGAGCGCATGCCAGTCAACGAGGGATGGAAGCCCGTCAACCACATCGATGGCTT
CTCGGTTGCTCAGGTGATCTTGCAGTTGGTTATGCGCACGCCAGAGAAGGTTACTGATGCCACTTCGCCGTCTGATAACTTCTGCATTGCGGGCTTCTGTGGTCTTTCGCCGGGCGGCTT
TTTCAAGTCTTTCCGGGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCTTCTTCCTCCTCAGCGCGCTGATTGCGTTTGTCTGCGCCGATGCCAACTTCGCAGACTGGCACCCGCAAGGCGACGGCGAAGTGCGCTCGCCCTGCCCAGCGCTCAACTCC
CTCGCCAACCACGGCATCCTCCCACGAGACGGGCACAACCTCACTGTACCCATCCTCGTCAAAGCCATGGGCGAAGGCCTCAACGTCTCCCCCGAAGTTGCCACCTCCCTGTCCAACCTC
GGCATGACTCTGTCCAAAAACACAGCCAGCGGCGCTTTCAACCTCGACGACTTGAACAAGCACAACGCCATTGAGCACGACGGCAGCCTCAGCAGGAAGGACATTGACCTCGGCGGCAAC
GAGAAGTTAGATGCCGATACGTTCAAGCAGACGCTGGGCTTCTACAAGGGCGCGAGCAACATTGGACTTGACGAAGTGGCTGCGGCCCGCTGGGGTCGTGTGCAGAACTCCAAGACGAGG
AACTCCAAGGTCCAGTATGGCGATGCGCAGCGGTTTCCGTCGTACTTTGAGTCTTCGGCGTATTATCAGCTGTTCAAGGATCCGAACTCGAGCAAGGCTAGGGTGGATTGGATCAAGGTC
TTTTTCC
AGGAGGAGCGCATGCCAGTCAACGAGGGATGGAAGCCCGTCAACCACATCGATGGCTTCTCGGTTGCTCAGGTGATCTTGCAGTTGGTTATGCGCACGCCAGAGAAGGTTACT
GATGCCACTTCGCCGTCTGATAACTTCTGCATTGCGGGCTTCTGTGGTCTTTCGCCGGGCGGCTTTTTCAAGTCTTTCCGGGCCTAG

Retrieve as FASTA