Entry information : CgHalPrx04 (CgHTPx4)
Entry ID 4205
Creation 2007-01-24 (Filippo Passardi)
Last sequence changes 2007-01-24 (Filippo Passardi)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2012-10-24 (Marcel Zamocky)
Peroxidase information: CgHalPrx04 (CgHTPx4)
Name (synonym) CgHalPrx04 (CgHTPx4)
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgHalPrx04
start..stop
S start..stop
AniHalPrx05 183 1e-58 1..164 1..167
NcHalPrx01 135 1e-38 14..252 34..269
PangHalPrx04 132 5e-38 32..225 48..231
MgrHalPrx01 125 3e-35 1..229 20..235
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4535846..4535942 97 N° 2 4535240..4535785 546 N° 3 4535016..4535158 143  
complement(join(4535016..4535158,4535240..4535785,4535846..4535942))


exon

Literature and cross-references CgHalPrx04 (CgHTPx4)
Literature Birren B. et al Annotation of the Chaetomium globosum CBS 148.51 Genome. Unpublished (2004)
Protein ref. UniProtKB:   Q2H8A8
DNA ref. JGI genome:   scaffold_2 (4535942..4535016)
Protein sequence: CgHalPrx04 (CgHTPx4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   261 (244)
PWM (Da):   %s   28631.12 (26966.2)  
PI (pH):   %s   4.79 (4.70) Peptide Signal:   %s   cut: 18 range:18-261
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLGSFASVALFSLAAAVEEPEGHEYHRNPADDRSPCPGLNVLANHGFLPRSGLNIDLETFRYAAHAGFNYKLGSVDQLFQAAIDFKLSTTGNSSTIHLSDLAKHDTIEMDGSLSRNDFLLGDDLTFDPAIWHTVALNLDLYNTGPSEADKYVTVETAAKARAARVKDAMAANPNFNASEAQMMGSPGTTALYLTTLWDDEADAAPKAWIRAFFEEERLPYLEGYDPATRREKTFDDVTAMFARVVAVNTEPSKCKRKFRS

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). Strain="CBS 148.51".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCGGTAGCTTTGCGAGTGTGGCTTTATTTAGCCTTGCTGCTGCGGTGGAAGAACCTGAGGGCCATGAGTATCATCGGAACCCGGCTGATGGTCAGTTTCACCAGCCATCCTCA
CCCCCATATTTGTACAATAACTTACCAAAAATCACAGACCGATCCCCCTGTCCCGGCCTCAACGTCCTAGCAAACCATGGTTTCCTACCTCGCTCGGGCTTGAACATCGACCTGGAGACG
TTCCGGTACGCCGCCCACGCAGGCTTCAATTACAAGCTCGGCTCCGTCGACCAGCTCTTCCAAGCAGCCATCGACTTCAAGCTGTCCACCACCGGCAACAGCTCCACCATCCACCTCTCC
GACCTGGCCAAGCACGACACCATCGAGATGGACGGCTCGCTGTCGCGCAACGACTTCCTCCTGGGCGACGACCTGACCTTCGACCCGGCCATTTGGCACACCGTCGCCCTGAACCTCGAC
CTCTACAACACGGGGCCGTCCGAGGCCGACAAGTACGTCACCGTCGAGACGGCGGCCAAGGCCCGCGCCGCACGCGTGAAGGACGCCATGGCCGCCAACCCGAACTTCAATGCCTCCGAG
GCTCAGATGATGGGCAGTCCGGGGACCACGGCGCTGTATTTGACGACGCTGTGGGATGACGAGGCTGATGCTGCGCCCAAGGCATGGATCAGGGCCTTTTTCG
GTAAGTTTTTCAGCGTT
TGATATTGCGTGGACGGTGGTCTCTGCTTGAATCAGGACAATGCTGATGATGGGACCTGAACAGAGGAGGAGCGCCTCCCGTACCTCGAGGGCTATGATCCCGCAACTCGCCGGGAAAAG
ACATTTGATGACGTTACCGCCATGTTTGCCAGAGTGGTTGCAGTGAACACCGAACCTAGCAAATGCAAGCGCAAGTTTAGGTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCGGTAGCTTTGCGAGTGTGGCTTTATTTAGCCTTGCTGCTGCGGTGGAAGAACCTGAGGGCCATGAGTATCATCGGAACCCGGCTGATGACCGATCCCCCTGTCCCGGCCTC
AACGTCCTAGCAAACCATGGTTTCCTACCTCGCTCGGGCTTGAACATCGACCTGGAGACGTTCCGGTACGCCGCCCACGCAGGCTTCAATTACAAGCTCGGCTCCGTCGACCAGCTCTTC
CAAGCAGCCATCGACTTCAAGCTGTCCACCACCGGCAACAGCTCCACCATCCACCTCTCCGACCTGGCCAAGCACGACACCATCGAGATGGACGGCTCGCTGTCGCGCAACGACTTCCTC
CTGGGCGACGACCTGACCTTCGACCCGGCCATTTGGCACACCGTCGCCCTGAACCTCGACCTCTACAACACGGGGCCGTCCGAGGCCGACAAGTACGTCACCGTCGAGACGGCGGCCAAG
GCCCGCGCCGCACGCGTGAAGGACGCCATGGCCGCCAACCCGAACTTCAATGCCTCCGAGGCTCAGATGATGGGCAGTCCGGGGACCACGGCGCTGTATTTGACGACGCTGTGGGATGAC
GAGGCTGATGCTGCGCCCAAGGCATGGATCAGGGCCTTTTTCG
AGGAGGAGCGCCTCCCGTACCTCGAGGGCTATGATCCCGCAACTCGCCGGGAAAAGACATTTGATGACGTTACCGCC
ATGTTTGCCAGAGTGGTTGCAGTGAACACCGAACCTAGCAAATGCAAGCGCAAGTTTAGGTCGTGA

Retrieve as FASTA