Entry information : GmPrx09 (Glyma04g40530.1)
Entry ID 425
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2005-06-21 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx09 (Glyma04g40530.1)
Name (synonym) GmPrx09 (Glyma04g40530.1)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Hypocotyls
Roots
Seedling epicotyls
Inducers Cyst nematode infection
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx09
start..stop
S start..stop
MtPrx07 577 0 1..327 1..327
GmPrx[P]157 510 0 56..326 1..271
CclPrx110 493 1e-177 1..326 3..328
CsPrx21 488 2e-175 9..326 11..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46559527..46559739 213 N° 2 46559862..46560053 192 N° 3 46560138..46560303 166 N° 4 46560389..46560801 413
join(46559527..46559739,46559862..46560053,46560138..46560303,46560389..46560801 )


exon

Literature and cross-references GmPrx09 (Glyma04g40530.1)
Literature Shoemaker et al Public Soybean EST Project. Alkharouf, N.W., Khan,R. and Matthews, B.F. unpublished.
DNA ref. Phytozome 12:   Gm04 (46559527..46560801)
Protein sequence: GmPrx09 (Glyma04g40530.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   35517.74 (32665.3)  
PI (pH):   %s   7.67 (6.50) Peptide Signal:   %s   cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKPNKLKCITTFFILYLFNQNAHSELQVGYYSYSCSMAEFIVKDEVRKGVTNNPGIAAGLVRMHFHDCFIRGCDASVLLDSTPLNTAEKDSPANKPSLRGYEVIDNAKAKLEAVCPGIVSCADIVAFAARDSVEFARGLGYDVPAGRRDGRISLASDTRTELPPPTFNVNQLTQLFARKGLTQDEMVTLSGAHTIGRSHCSAFSSRLYNFSTTSSQDPSLDPSYAALLKRQCPQGSTNQNLVVPMDPSSPGIADVGYYVDILANRGLFTSDQTLLTNAETASQVKQNARDPYLWASQFADAMVKMGQIIVLKGNAGEIRTNCRVVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic and 10 partial ESTs. No nodulated seedling.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCCAAATAAGCTTAAATGTATAACTACATTTTTTATCCTATATTTGTTCAATCAAAATGCTCATTCTGAGCTGCAGGTTGGGTATTACAGCTATTCATGTAGCATGGCTGAGTTC
ATTGTGAAGGATGAAGTCAGAAAAGGTGTTACTAATAATCCTGGAATTGCAGCTGGGCTAGTAAGAATGCATTTTCATGATTGCTTTATTAGA
GTAAGTCATTAACTCATTATATGAAGT
CATTTATTATTTATCCATTCCCCTTAAATCTTGGTAGTAAAATTTGGTAATTACCTGTTTTCTGTAGTAAAATTTAACCGCTTTGTTAAATTTAGGGGTGTGATGCATCAGTGCTTCTTG
ATTCCACTCCCTTAAACACTGCAGAGAAAGACTCTCCCGCAAATAAACCAAGTCTCCGAGGATATGAAGTCATTGATAATGCCAAGGCTAAACTAGAAGCAGTATGCCCAGGAATTGTTT
CATGCGCTGACATTGTTGCATTTGCAGCAAGGGACAGTGTGGAGTTT
GTAAGTTTGCCTACTTTGTTCTATAAAGTAGAAACATCTTTGAAAGCAAGAAAATGACCTTGTATTATTCCTT
GCTTCACACAGGCTCGAGGGCTTGGTTATGATGTTCCAGCAGGAAGAAGAGATGGCAGAATCTCACTAGCTTCAGATACAAGAACAGAGTTACCTCCTCCAACTTTCAATGTAAACCAAC
TCACTCAACTCTTTGCAAGAAAGGGATTAACACAAGATGAAATGGTCACCCTTTCAG
GTATACATTGAGCTTCAACATAACTCTTCTTTATGGTTTTGCTTGTAGCTTAAATTTGCTAAT
GGCATGTACATTGTGCATGCAGGAGCACACACCATCGGTCGCTCTCATTGCTCGGCTTTCAGCAGCAGATTATACAACTTCAGTACCACTTCAAGCCAGGATCCAAGTTTAGATCCCTCA
TATGCAGCACTTCTGAAGCGGCAATGTCCACAAGGCAGCACAAACCAAAACTTGGTGGTTCCAATGGACCCTTCAAGTCCTGGAATTGCTGATGTGGGGTACTATGTTGATATATTAGCA
AACCGAGGCCTCTTCACATCTGACCAAACTCTCTTAACTAATGCTGAAACAGCCAGCCAGGTGAAACAAAATGCCAGGGATCCCTATTTATGGGCAAGTCAATTTGCAGATGCAATGGTG
AAGATGGGTCAAATCATTGTCTTAAAAGGTAATGCTGGAGAGATTAGAACAAATTGCAGGGTGGTCAATAGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCCAAATAAGCTTAAATGTATAACTACATTTTTTATCCTATATTTGTTCAATCAAAATGCTCATTCTGAGCTGCAGGTTGGGTATTACAGCTATTCATGTAGCATGGCTGAGTTC
ATTGTGAAGGATGAAGTCAGAAAAGGTGTTACTAATAATCCTGGAATTGCAGCTGGGCTAGTAAGAATGCATTTTCATGATTGCTTTATTAGA
GGGTGTGATGCATCAGTGCTTCTTGAT
TCCACTCCCTTAAACACTGCAGAGAAAGACTCTCCCGCAAATAAACCAAGTCTCCGAGGATATGAAGTCATTGATAATGCCAAGGCTAAACTAGAAGCAGTATGCCCAGGAATTGTTTCA
TGCGCTGACATTGTTGCATTTGCAGCAAGGGACAGTGTGGAGTTT
GCTCGAGGGCTTGGTTATGATGTTCCAGCAGGAAGAAGAGATGGCAGAATCTCACTAGCTTCAGATACAAGAACA
GAGTTACCTCCTCCAACTTTCAATGTAAACCAACTCACTCAACTCTTTGCAAGAAAGGGATTAACACAAGATGAAATGGTCACCCTTTCAG
GAGCACACACCATCGGTCGCTCTCATTGC
TCGGCTTTCAGCAGCAGATTATACAACTTCAGTACCACTTCAAGCCAGGATCCAAGTTTAGATCCCTCATATGCAGCACTTCTGAAGCGGCAATGTCCACAAGGCAGCACAAACCAAAAC
TTGGTGGTTCCAATGGACCCTTCAAGTCCTGGAATTGCTGATGTGGGGTACTATGTTGATATATTAGCAAACCGAGGCCTCTTCACATCTGACCAAACTCTCTTAACTAATGCTGAAACA
GCCAGCCAGGTGAAACAAAATGCCAGGGATCCCTATTTATGGGCAAGTCAATTTGCAGATGCAATGGTGAAGATGGGTCAAATCATTGTCTTAAAAGGTAATGCTGGAGAGATTAGAACA
AATTGCAGGGTGGTCAATAGTTAG

Retrieve as FASTA