Entry information : GmPrx06 (sEPb2 / Glyma11g08520.1)
Entry ID 427
Creation 2006-10-30 (Christophe Dunand)
Last sequence changes 2011-10-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx06 (sEPb2 / Glyma11g08520.1)
Name (synonym) GmPrx06 (sEPb2 / Glyma11g08520.1)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Roots
Seed buds
Seedlings
Stems
Whole seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx06
start..stop
S start..stop
GmPrx88 629 0 1..316 1..317
MtPrx08 572 0 1..316 1..316
LjPrx29 551 0 1..316 1..316
MtPrx92 531 0 17..316 20..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6021708..6021911 204 N° 2 6021421..6021609 189 N° 3 6021121..6021283 163 N° 4 6020620..6021014 395
complement(join(6020620..6021014,6021121..6021283,6021421..6021609,6021708..6021 911))


exon

Literature and cross-references GmPrx06 (sEPb2 / Glyma11g08520.1)
Literature Shoemaker,R. et al., unpublished.
Protein ref. UniProtKB:   Q9ZRG5
DNA ref. Phytozome 11:   Gm11 (6021911..6020620)
Protein sequence: GmPrx06 (sEPb2 / Glyma11g08520.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (297)
PWM (Da):   %s   34080.33 (32013.2)  
PI (pH):   %s   9.43 (9.43) Peptide Signal:   %s   cut: 20 range:20-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVMVAFLNLIIMFSVVSTSKSLSLNYYSKTCPDVECIVAKAVKDATARDKTVPAALLRMHFHDCFVRGCDASVLLNSKGSNKAEKDGPPNVSLHAFYVIDAAKKALEASCPGVVSCADILALAARDAVFLSGGPTWDVPKGRKDGRTSKASETRQLPAPTFNLSQLRQSFSQRGLSGEDLVALSGGHTLGFSHCSSFKNRIHNFNATHDVDPSLNPSFATKLISICPLKNQAKNAGTSMDPSTTTFDNTYYRLILQQKGLFSSDQVLLDNPDTKNLVAKFATSKKAFYDAFAKSMIKMSSINGGQEVRKDCRVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 13 EST. Roots of 8 day old 'Bragg' supernodulating mutant NTS382 seedlings. TAE in place of KDCRVIN in the NCBI cDNA accession U51194.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCATGGTTGCATTCTTGAATTTGATCATCATGTTTTCAGTAGTCTCTACAAGCAAGTCACTGAGCTTAAACTACTATTCAAAAACATGCCCTGATGTGGAATGCATTGTTGCC
AAGGCAGTGAAGGATGCCACTGCTAGGGACAAAACTGTTCCAGCTGCACTTCTGCGAATGCACTTCCATGACTGTTTCGTTCGG
GTAATGACCCCACCCCCCTCATTTCCTCTTGACAGC
TCCGCTTTATTTGATGCATTATTAAATCAAATCATATTATCTTTTTTCCTATACTCTTGAAGGGGTGTGATGCCTCTGTGCTGCTAAATTCAAAAGGAAGCAACAAAGCAGAAAAAGATG
GGCCACCAAATGTTTCTTTGCATGCATTCTATGTCATTGATGCAGCGAAGAAAGCACTAGAAGCTTCATGCCCAGGTGTGGTCTCTTGTGCTGACATCCTTGCTCTAGCAGCAAGGGATG
CAGTTTTTCTG
GTAAGAAAACTTTGTTAAGTACCAAATTTCTCATCATTCAGATCCTAAACAATTCTTATGTCTTCGAGAATTGACAAATGCAGCTAAGGTAGCTTGTATTTGCAAGTCT
TGACTAATGGTATAAATATATTCTGCAGTCAGGAGGACCTACATGGGATGTTCCTAAAGGAAGAAAGGATGGCAGAACATCTAAAGCCAGCGAAACCAGACAATTACCAGCGCCAACCTT
CAACTTATCACAACTGCGGCAAAGCTTTTCTCAAAGAGGACTGTCAGGGGAAGACCTGGTAGCTCTGTCAG
GTAAGTTATTCCTAAAGTCAAAACTGCCAAAACTTGACCATTTTTCATT
TATTCCAATTTATATCTGAATAGAGTTTAGAGTAAATGTCCTTTGACCCATATGTAGGGGGGCACACTTTGGGTTTCTCTCACTGCTCATCTTTCAAGAACAGAATCCACAACTTCAATG
CTACACATGATGTTGACCCTTCATTAAATCCATCATTTGCAACAAAACTGATATCAATTTGTCCACTAAAAAATCAGGCAAAAAATGCAGGCACCTCTATGGACCCTTCAACAACAACTT
TTGATAATACATATTACAGGTTGATCCTCCAACAGAAAGGCTTGTTTTCTTCTGATCAAGTTTTGCTTGACAACCCAGACACTAAAAATCTGGTTGCGAAGTTTGCCACCTCAAAAAAGG
CTTTTTATGACGCTTTTGCAAAGTCCATGATCAAAATGAGTAGCATCAATGGTGGACAGGAGGTTAGAAAGGACTGCAGAGTGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCATGGTTGCATTCTTGAATTTGATCATCATGTTTTCAGTAGTCTCTACAAGCAAGTCACTGAGCTTAAACTACTATTCAAAAACATGCCCTGATGTGGAATGCATTGTTGCC
AAGGCAGTGAAGGATGCCACTGCTAGGGACAAAACTGTTCCAGCTGCACTTCTGCGAATGCACTTCCATGACTGTTTCGTTCGG
GGGTGTGATGCCTCTGTGCTGCTAAATTCAAAAGGA
AGCAACAAAGCAGAAAAAGATGGGCCACCAAATGTTTCTTTGCATGCATTCTATGTCATTGATGCAGCGAAGAAAGCACTAGAAGCTTCATGCCCAGGTGTGGTCTCTTGTGCTGACATC
CTTGCTCTAGCAGCAAGGGATGCAGTTTTTCTG
TCAGGAGGACCTACATGGGATGTTCCTAAAGGAAGAAAGGATGGCAGAACATCTAAAGCCAGCGAAACCAGACAATTACCAGCGCCA
ACCTTCAACTTATCACAACTGCGGCAAAGCTTTTCTCAAAGAGGACTGTCAGGGGAAGACCTGGTAGCTCTGTCAG
GGGGGCACACTTTGGGTTTCTCTCACTGCTCATCTTTCAAGAAC
AGAATCCACAACTTCAATGCTACACATGATGTTGACCCTTCATTAAATCCATCATTTGCAACAAAACTGATATCAATTTGTCCACTAAAAAATCAGGCAAAAAATGCAGGCACCTCTATG
GACCCTTCAACAACAACTTTTGATAATACATATTACAGGTTGATCCTCCAACAGAAAGGCTTGTTTTCTTCTGATCAAGTTTTGCTTGACAACCCAGACACTAAAAATCTGGTTGCGAAG
TTTGCCACCTCAAAAAAGGCTTTTTATGACGCTTTTGCAAAGTCCATGATCAAAATGAGTAGCATCAATGGTGGACAGGAGGTTAGAAAGGACTGCAGAGTGATCAATTAA

Retrieve as FASTA