Entry information : GmPrx08 ( Glyma09g02600.1)
Entry ID 428
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2005-06-21 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-24 (Christophe Dunand)
Peroxidase information: GmPrx08 ( Glyma09g02600.1)
Name (synonym) GmPrx08 ( Glyma09g02600.1)
Class Class III peroxidase    [Orthogroup: Prx044]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Etiolated hypocotyls
Roots
Roots hairs
Seedlings
Inducer Salicylic acid treatment
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx08
start..stop
S start..stop
GmPrx85 659 0 1..355 1..354
MtPrx10 573 0 1..355 1..353
GmPrx57 563 0 1..355 1..350
GmPrx69 561 0 19..355 14..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1779904..1780125 222 N° 2 1780646..1780837 192 N° 3 1781219..1781384 166 N° 4 1781706..1782193 488
join(1779904..1780125,1780646..1780837,1781219..1781384,1781706..1782193)


exon

Literature and cross-references GmPrx08 ( Glyma09g02600.1)
Literature Scheffler,B.E unpublished Shoemaker,R et al Public Soybean EST Project
Tian,A.G. et al Characterization of soybean genomic features by alysis of its expressed sequence tags Theor. Appl. Genet. 108 (5), 903-913 (2004).
DNA ref. Phytozome 11:   Gm09 (1779904..1782193)
Protein sequence: GmPrx08 ( Glyma09g02600.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355 (328)
PWM (Da):   %s   38384.46 (35584.0) Transmb domain:   %s   i2-24o
PI (pH):   %s   5.9 (5.96) Peptide Signal:   %s   cut: 28 range:28-355
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGCFHLTVTSLCFVVVVVGVLPLSLDAQLDPSFYRDTCPKVHSIVREVVRNVSKKDPRMLASLIRLHFHDCFVQGCDASVLLNNTATIESEQQALPNNNSLRGLDVVNDIKTAVEQACPGVVSCADILTLASEISSILGGGPDWKVPLGRRDSLTANRTLANQNLPAPFFNLTQLKAAFAVQGLDTTDLVALSGAHTFGRAHCSFILGRLYNFSGTGKPDPTLDTTYLQQLRQICPNGGPNNLVNFDPVTPDKIDRVYFSNLQVKKGLLQSDQELFSTPGADTIPIVNRFSSDQNVFFDAFEASMIKMGNIGVLTGNKGEIRKHCNFVNKKSVELDIATVASEESSSEEGMVSSI

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 40 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTGTTTCCATCTCACAGTGACTAGTCTGTGCTTTGTAGTGGTTGTGGTTGGAGTGCTTCCACTCTCCTTAGATGCACAACTAGATCCCTCGTTTTACAGAGACACGTGTCCCAAG
GTTCACTCCATTGTTCGCGAAGTGGTGAGGAACGTTTCCAAGAAAGATCCCCGCATGCTTGCCAGTCTCATTAGACTTCACTTTCATGACTGTTTTGTTCAA
GTATGTTTACTTATTTAT
GAACTTCATCTTTCTGCTGTCTTTTTTGATGTTGTTCTTTAAAACGAAGTAGTTTTGATTCAAAATGACGTCGTTTTAAAACATAACTTTCAAAACGACATCATTTTAGAGAAACATGCA
ACACAAGCACAACACAAAAAAAGGACAATCAATTTTTTTATTTATTCACTTTATTCATCTTAAAGTTTCAAGTTTTCTAGTCTCATTATACTCCACTTTTATTATTTCTTTCAAGTGTTA
TAAAAAGGAGCACGGGTATCCGTTGGAAGTAATTTTTAAAGCACATTGGACACAAACACATTATTTTTTTCTCTCACCCAGAACGTATATGCTCCAAACTTCAACGACATGTCTTTTATT
TTAGAAAGAGTAGTGTATGTGAAAATCATACACTTCAAATATGGATATGAGAGAATACTACCATTTCATTCTCATCCATAGGTGTTTTGAATACTAACAAGAAATATGAATTGATTATGT
TGTTGATGTTTGTGACATTCAGGGATGTGACGCATCAGTTTTGTTGAACAACACTGCCACCATAGAGAGTGAGCAACAAGCTCTGCCAAACAACAACTCTCTAAGAGGTTTGGATGTTGT
GAACGACATCAAGACAGCAGTTGAACAGGCTTGCCCCGGCGTGGTTTCTTGTGCTGATATTCTTACCCTTGCATCTGAAATATCTTCTATTCTG
GTATGGATTAATGCTATTTCTAATTC
ATTTTGCTTCTGTGCTGAGTATAAAATCACATTGTATATATATGTTTCAAATCTTTGACAAATGTTTAATTTCAAGAGTAGAGTTTAGATAGAATCATTATCATAAAGTATACTAACCAA
AAAAGGTTGCAATCAATTACACATGATATGTCTAAGGTTTCACTCATTTCAATCATAATTAAATGAAAGATCTTTCACAAAACATAGTTGAGTCTATCATGATCCTGTAACATTGATAAT
TATTACATAGCTCAAAGTCTATATTATTATTAGTCATGTTTAATTAAGAACACCTTTTACTTTATTGGTCTTAAAATGATACATCTTACAAATATGTATATTAATTAATATATAGGGTGG
TGGTCCTGATTGGAAAGTTCCATTGGGAAGAAGAGATAGTTTAACAGCAAATCGAACCCTTGCCAATCAAAACCTTCCTGCTCCTTTCTTCAACCTCACTCAACTTAAAGCTGCCTTTGC
TGTTCAAGGTCTTGACACTACTGATCTAGTTGCACTCTCAG
GTAAGAAAATCTTCCCAATTAAATTCATCCTATATATGTTGCAAAATTTAAAAAATAACAATGATAAATAGGAAAATTC
TTGAAATTCAGGGTAAGGTAAGATATTGGATTCAAAGGGATATATTATTAATGAAACCATTGACATTACTCTAAAAAAGAGAGTCCGTGATGGATTAGTATATGATTTTTACATGATTCT
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTACCACACTAGGATTAAAAAAAATGATTTATGCATGATTGAATTTC
AGGTGCTCATACATTTGGCAGAGCTCACTGCTCTTTCATTCTTGGGCGATTGTACAATTTCAGTGGCACAGGCAAACCTGATCCAACTCTTGACACAACTTACTTGCAACAATTGCGCCA
AATATGCCCGAATGGTGGACCCAACAACCTTGTGAATTTTGACCCTGTCACTCCTGATAAAATTGACAGGGTCTACTTCTCCAATCTTCAGGTCAAGAAGGGCTTGCTTCAGAGTGATCA
AGAGCTGTTCTCGACACCCGGTGCCGATACCATTCCCATTGTCAATAGGTTCAGCAGTGACCAAAATGTCTTCTTTGATGCCTTTGAGGCTTCAATGATTAAGATGGGTAACATTGGTGT
GCTCACTGGGAACAAAGGAGAAATCAGAAAACATTGTAACTTTGTTAACAAGAAATCTGTTGAACTTGATATTGCTACTGTGGCCTCCGAAGAATCATCATCAGAGGAGGGTATGGTTAG
CTCAATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTGTTTCCATCTCACAGTGACTAGTCTGTGCTTTGTAGTGGTTGTGGTTGGAGTGCTTCCACTCTCCTTAGATGCACAACTAGATCCCTCGTTTTACAGAGACACGTGTCCCAAG
GTTCACTCCATTGTTCGCGAAGTGGTGAGGAACGTTTCCAAGAAAGATCCCCGCATGCTTGCCAGTCTCATTAGACTTCACTTTCATGACTGTTTTGTTCAA
GGATGTGACGCATCAGTT
TTGTTGAACAACACTGCCACCATAGAGAGTGAGCAACAAGCTCTGCCAAACAACAACTCTCTAAGAGGTTTGGATGTTGTGAACGACATCAAGACAGCAGTTGAACAGGCTTGCCCCGGC
GTGGTTTCTTGTGCTGATATTCTTACCCTTGCATCTGAAATATCTTCTATTCTG
GGTGGTGGTCCTGATTGGAAAGTTCCATTGGGAAGAAGAGATAGTTTAACAGCAAATCGAACCCTT
GCCAATCAAAACCTTCCTGCTCCTTTCTTCAACCTCACTCAACTTAAAGCTGCCTTTGCTGTTCAAGGTCTTGACACTACTGATCTAGTTGCACTCTCAG
GTGCTCATACATTTGGCAGA
GCTCACTGCTCTTTCATTCTTGGGCGATTGTACAATTTCAGTGGCACAGGCAAACCTGATCCAACTCTTGACACAACTTACTTGCAACAATTGCGCCAAATATGCCCGAATGGTGGACCC
AACAACCTTGTGAATTTTGACCCTGTCACTCCTGATAAAATTGACAGGGTCTACTTCTCCAATCTTCAGGTCAAGAAGGGCTTGCTTCAGAGTGATCAAGAGCTGTTCTCGACACCCGGT
GCCGATACCATTCCCATTGTCAATAGGTTCAGCAGTGACCAAAATGTCTTCTTTGATGCCTTTGAGGCTTCAATGATTAAGATGGGTAACATTGGTGTGCTCACTGGGAACAAAGGAGAA
ATCAGAAAACATTGTAACTTTGTTAACAAGAAATCTGTTGAACTTGATATTGCTACTGTGGCCTCCGAAGAATCATCATCAGAGGAGGGTATGGTTAGCTCAATCTAA

Retrieve as FASTA