Entry information : DdBCP02
Entry ID 4321
Creation 2007-01-29 (Filippo Passardi)
Last sequence changes 2012-05-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-23 (Christophe Dunand)
Peroxidase information: DdBCP02
Name DdBCP02
Class Atypical 2-Cysteine peroxiredoxin (type BCP)    [Orthogroup: BCP002]
Taxonomy Eukaryota Dictyostelium
Organism Dictyostelium discoideum (Slime mold)    [TaxId: 44689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DdBCP02
start..stop
S start..stop
DdBCP01 213 7e-72 1..152 46..196
DdBCP05 203 9e-69 1..152 1..151
DdBCP04 203 9e-69 1..152 1..151
DdBCP03 202 2e-68 1..152 1..151
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 399..549 151 N° 2 1..308 308  
complement(join(1..308,399..549))


exon

Literature and cross-references DdBCP02
Literature Eichinger L. et al. The genome of the social amoeba Dictyostelium discoideum. Nature 435 (7038), 43-57 (2005)
Protein ref. UniProtKB:   Q54W09
DNA ref. GenBank:   AAFI02000035 (117956..118504)
Cluster/Prediction ref. UniGene:   Ddi.3370
Protein sequence: DdBCP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   152
PWM (Da):   %s   16745.63  
PI (pH):   %s   6.26
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKLKVGDQAPDFTCPDKDGKLVSLKDFIKDQKPIVLYFYPKDETSICTKEACEFRDKYQKFIEAGADVIGVSRDDAESHSKFTSKYSLPFTLLTDKGGELAKLYGAEGNFLSPGRVTFIIDKNGKVALNHSALLSATSHIEESLKVIEQLK

Retrieve as FASTA  
Remarks Complete sequence from Genomic DNA (Chromo 3, 2 exons) and 7 ESTs. No N-terminal extension predicted (cf. DdBCP01). One EST (AU037281) contains a partial N-Term without match against the genome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAAATTAAAAGTTGGTGACCAAGCTCCAGATTTCACATGTCCAGATAAAGATGGAAAATTAGTTTCTTTAAAAGATTTCATTAAAGATCAAAAACCAATTGTATTATATTTTTAC
CCAAAGGATGAAACTTCTATTTGCACTAAAG
GTATGTCTTAATATATAATATATATACACTATATACATTATTATTTATTATTAATTCTTTTTTTTAAAAAAAAAAAAAATATAAATATA
GAGGCTTGTGAATTCAGAGATAAATATCAAAAGTTTATTGAAGCAGGTGCAGATGTTATTGGTGTCAGTAGAGATGATGCAGAAAGTCATTCAAAATTCACATCAAAATATTCATTGCCA
TTCACATTATTAACTGATAAAGGTGGTGAATTAGCTAAATTATATGGTGCTGAAGGTAACTTTTTATCACCTGGTAGAGTCACTTTTATTATTGACAAAAATGGAAAAGTAGCTCTAAAT
CATTCAGCTTTATTAAGTGCAACATCACACATTGAAGAATCTTTAAAAGTTATTGAACAATTAAAATAA

Retrieve as FASTA