Entry information : AtPrxII02 (At1g65980 / TPx1 / PRXIIB / PeroxiredoxinIIB / Thioredoxinreductase2B / AtPrxIIB)
Entry ID 4344
Creation 2007-01-31 (Christophe Dunand)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-17 (Christophe Dunand)
Peroxidase information: AtPrxII02 (At1g65980 / TPx1 / PRXIIB / PeroxiredoxinIIB / Thioredoxinreductase2B / AtPrxIIB)
Name (synonym) AtPrxII02 (At1g65980 / TPx1 / PRXIIB / PeroxiredoxinIIB / Thioredoxinreductase2B / AtPrxIIB)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Buds
Inflorescences
Leaves
Mixed tissues
Roots
Seeds
Siliques
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrxII02
start..stop
S start..stop
AlyPrxII02 324 3e-116 1..162 1..162
BrPrxII03_other 321 7e-115 1..162 1..162
AtPrxII03 316 4e-113 1..162 1..162
AlyPrxII03 315 1e-112 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24560599..24560753 155 N° 2 24560311..24560390 80 N° 3 24559524..24559777 254  
complement(join(24559524..24559777,24560311..24560390,24560599..24560753))


exon

Literature and cross-references AtPrxII02 (At1g65980 / TPx1 / PRXIIB / PeroxiredoxinIIB / Thioredoxinreductase2B / AtPrxIIB)
Literature Verdoucq L., Jacquot J.-P., Vignols F., Chartier Y., Meyer Y. Submitted (JAN-1999)
Protein ref. UniProtKB:   Q9XEX2   Q8L9P7 [Mismatch] UniProtKB_Uniparc:   Q2V4E9 [Fragment]
DNA ref. Phytozome 11:   Chr1 (24560753..24559524)
Cluster/Prediction ref. Phytozome Gene 11:   19649394 UniGene:   At.20543
Omic ref. AtProteome:   At1g65980 ATTED-II:   At1g65980 e-FP Browser:   At1g65980 Genevestigator:   At1g65980 TAIR:   At1g65980
Protein sequence: AtPrxII02 (At1g65980 / TPx1 / PRXIIB / PeroxiredoxinIIB / Thioredoxinreductase2B / AtPrxIIB)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17303.9  
PI (pH):   %s   5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKAEELKSKGVDEIICFVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGLGVRSRRFALLLDDLKVTVANVESGGEFTVSSADDILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 2 introns), 9 cDNA and 144 ESTs. Three TREMBL accessions Q9XEX2, Q8L9P7 (one mRNA included in the UniGene and 7 mismatches) and Q2V4E9 (fragment).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATAGATCTCA AAGCTCACTA TAAATCTCGA AGAAAGAGGT GTTGGGCCAC CCTCAGAAAA GTTTACTTCA GCGACTTGTG GACCGGCACA GCTACTTTAG CCGCCGTGCT TCTCTTGCTT  TTGACTCTGG TTGGGACGGT GGCTTCTGTC ATCCAAGCTT ACGAAAGCTT CAAGTAACTA TATATGCTTT TATAATTCAT ACAAAAACAA AAAAAAAAAA CTATATATGC TTTTATATCG  TCCAAAAACT TATTTCCAAG TTTTCCTCAT GGATTATTTA TGTACTTTGG TGATTGATTC TTGATTTCTC TAAAGATTGT CTTTTAACAC GGAACAAGTC TACGAAATTT CTACATTAAC  TTTTCCTCTT GGCCAAACGT CTATGGATTA TTCCCATGCG ACGAACCAAA GACTTGATAC CCAAAACCAG AAAGATATTA CTGTATGTAT ATATAAATGT TCGCACCAAC TTAGAAGGGC  AAAAACTAAG TACGCATTCC AATAGACACA ACATTAATGG TTACGTAGTG GATGCTAATT AAGAGTGTTC AGTACTGTCT GTCGATTGAC AATCACAAAC GTTCGGAGGG CAATCATTGA  CGTTCTGAAC CGTCAATTTG CGTTTGGACA GAACCTATGG TACAAAACAG GCCACAGTGC GAGTTTGTTT CCACAATAAA ATGATGCTGG GATTATGGAG AACAAATCCC AGATTTATTA  TTGTGAAATA AGAGATTTTG TTGTCTCCCG TGTAAGAATT AAACAAGATA ATATTTTGTG CATCTTGCCC CATATACTAT ATATTTATCG AAAAGGAGGT ACCATCATAA TTTTACTAGC  TGAACCATTT TGGATAGTCT TTAGCTGGAG AGACAGATTT TGCAATTACT TCCATAGTTA TAAACATAAA AAAGCAACCC ATAAAAAAAA TTTATAAAAA AAAATCATAT AAATTTTTTT  GAGTGTATGT CAAGTAACAT TTTGTGCTTG TAATATATTT TTTCAAATTT GAAAATTTTG GATCCTCACT TTTGGATCTC ACCATTGGAT AGCTCAAAAT AAAAAAAAAG TTCAAAATGT  CTAAATTTTT GCTTTTCTAT TATACAAATT GTAAATCTTG GTTGGATCCC AATTTTTGAA TCCAACCATT GAAGTTGCTC TAACAATATA ACTTTCAAAA GAGTCCAAAG AAGGTCCAAG  AATAAAAAAA CAATAGGAAT AAGCTAAGGA CACGTGTTTG CTTCCACAAC CTTTAACACA TACCAGAGAT TCTAAATCTG GTTAATCGGA AACTTCGCCA AATCCAGCAA TGAATCCTTT  TTTTTTCCAC CAATAATGAC AATTATGAAT TTTGTTTTAG TGATTCCAAA AGAAAATCAC GAGAAGATTG AGATATGAAT TACGACTAAG ATTTTTATAT AATTTGAAAA CCATAGTAAA  TCAACGATAA AAAGAATGAC TATTAAAACA ATAGTTTTAA AGTGGTATAC GCGGTTGTCG AGACCCCGAC TAAGTTCTAG ATACTCAAGC GATGGATAAA CGACCATCTA AAAATGCATA  AGTTTTGTTT TAATGTATTC TTTTTGTTAA TTTCTAACTA AATTTTAGCA CATAGTTATA AGCCTTTTAT ATATTTTTTA ATAAAACTAA ATAAATGTTT TGTCCAAATT TTGCTTAAAT  TAATAATTCC ATTTTCTACT AGACATTTTT ATATAATTTG TATGTAATAT CATATATTTG TAATATTATG TAACACAGAC CTTACCTACC ACCTAACACC AAATTGTTGT ATTTTTAGAA  AGCCAATATA CATCTAATAG ATCATTATCT TAGAAATATC CTTTTATCTC ATTCTGGAAA CTTCTTACCA TAACAGAAAA TAAACAAATC TCATTCCGGA AAACGCTCAT AAATTGTCCG 
AAAGCCCTAA AAATCTGAGT CTCGCATTAA GTCCAAACAC TTTCATTTGT CTCCTTTCGT CAACTCCACA GAGATCTCCT C 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAATGTACC ACTTGTGTTG TCTATGTAAA CCGCTGTATG TGTAGTAGAG GATTCTATAG CTTGTTCTCA GACATTAACC AAGGTTGTAA TAAAGCGGTT TCATTGTGAC TTGTTTGGCA  TAACAAAGTA TTTGGTTTTG TTGTTTTTCT GTGCGTTGAT TAATGAAAGA TGTGACTCAT TGACGTGAAC ATTTATGCCA AATTTTGCCA TTGTTGTTCT TGACTATGGT AGACACATAC  CAAAAAGTTA GGTTACCTGA GTTTCTGGTA AGTATAGTTG CTATATTGCA TTTATAATGT ACATAGGCTT CTCACACATT ATCAAACTTT GGTAAGTTTG TCTCTATTTT TTTTACCGCT  CTATCTTTTA GCCTTGCTCA TCGGATATAT ATGTCCGATG ACGCTTATCT TGATTGTGTA AGCGTATGAC CCTTTTTTTG TTTTGTGCGG TATCTAATGC TTATCTTGAT TGTGTAAGCG  TATGACCTTC TATTTGTTTT GTGCGGTATT CAATTCAACA TGTTGAATTT GAAAATAATA GTAAGAGAAG TACAAATTGC AAATTATACT AAATTGTTAT AAGATTGCAA TTCAATTTTA  GCATTTAGAG TGCTTATTGA AATTAGAAAA GTATAGGATC CGCGTGTTTA TCATATGGGC GGGCTAGGAT CAAATAGGTC GAATCACGAA ATCAAATAAT AACTAATCAG GTCTTAACAA  TGTTTTTACG ATAGATTTAG TCTTAACCAT TCATTTTGTT TGGTATGTAA TTAAAAGCTA ATCAAGGGCA TATTCTCTCT CTATTCGATT GTATTCTCTA GAGAAACGAT TTTCATATAT  TTCCTAATCA AAATAGCATA TTTGAATTAT TAATTTGTTT CCCTCAATAA GGTTACGAAT ATGATGCATT AATTTTGGAT TTAAAAAATC TTGCTTGCTC ACGAAGAAAT CAGACTCAAT 
TTTTATCGTC ATACAATGTT TTCCAAAATA TGTGTACATG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCAATTGCTGTCGGCGATGTCGTACCAGACGGAACTATCTCCTTCTTCGATGAGAATGATCAACTTCAGACCGCCTCCGTTCACTCTCTCGCCGCCGGTAAAAAAGTCATTCTC
TTTGGTGTTCCTGGTGCTTTCACTCCCACTTGCAG
GTACAAAGTTTCAACCTTTTTCATCATCTCTCACTTAATTTGCTTTCAAAGTTTTGATCTTTCTTTTTCTTGTTCTCAATACAGA
TTAGGTTTTGTTTCTTCAGATTTATCATTCTAATTAGTTGTATAAGATGTGGGATTTGATGGTAAGATGATGGATCTTTAGATTTGATTTGAGAATGGTGTTTTTGTTTTTTTGTGAGGT
TAGCATGAAGCATGTTCCTGGGTTCATTGAGAAAGCAGAGGAGCTGAAGTCAAAGGGTGTTGATGAGATCATTTGCTTTAGCGGTGAGTATGAATGATATGCTTTTGATCTCTATAATGA
GTTTGAGTATACTTCTGAAACCTCTATGATATGATATGTTCTTACCTATTATTAGATTCGTTTGGTAGTTGGTGTCCCTATTTGTAAATTGTAGAGTATACAATTAGATCAGTTAGTGTA
TTTGGCTGAGTCTGCTTCTTGTGCAAATGTTTTGGCAGACGTTTATATATGCTGCTTGGTTTTATAGTATTTACGCCGTCATTTGGATCGATTGTTGCAGTGAACTGTTCATCATATGTA
TATGGTTTGATATCAGGTCTGTTCTTAGGTATAACCTGTACTATTTCTGACCTTTGTGTTTGTGTCTACTTCTGAAATCTGATCTCTTGCTAGTCAAACATGTGAAAGCTAGGCTAATGG
TAGTTGGTATTCATAATAGTAAATTGTAGAAGAGATTCAGAGTATTGGTTAATGTATTTGGTTGAGTTTGCTTGATGGTAGACTGATTCAAATGGTTTATGGCATTGACGTTATCACTTG
GATTGATATGTTGCAGTGAACGATCCGTTTGTGATGAAAGCATGGGGAAAAACATACCCAGAGAACAAACATGTGAAGTTTGTAGCTGATGGGTCTGGAGAATACACACACCTTCTCGGA
CTTGAGCTTGACCTTAAAGACAAGGGTCTTGGTGTTAGGTCAAGGAGATTTGCTCTGTTACTTGATGATCTCAAAGTGACTGTAGCCAATGTCGAATCTGGTGGCGAATTCACAGTTTCC
AGCGCCGATGATATCCTCAAGGCTCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCAATTGCTGTCGGCGATGTCGTACCAGACGGAACTATCTCCTTCTTCGATGAGAATGATCAACTTCAGACCGCCTCCGTTCACTCTCTCGCCGCCGGTAAAAAAGTCATTCTC
TTTGGTGTTCCTGGTGCTTTCACTCCCACTTGCAG
CATGAAGCATGTTCCTGGGTTCATTGAGAAAGCAGAGGAGCTGAAGTCAAAGGGTGTTGATGAGATCATTTGCTTTAGCGTGAAC
GATCCGTTTGTGATGAAAGCATGGGGAAAAACATACCCAGAGAACAAACATGTGAAGTTTGTAGCTGATGGGTCTGGAGAATACACACACCTTCTCGGACTTGAGCTTGACCTTAAAGAC
AAGGGTCTTGGTGTTAGGTCAAGGAGATTTGCTCTGTTACTTGATGATCTCAAAGTGACTGTAGCCAATGTCGAATCTGGTGGCGAATTCACAGTTTCCAGCGCCGATGATATCCTCAAG
GCTCTCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGATCATTAT CTTAGAAATA TCCTTTTATC TCATTCTGGA AACTTCTTAC CATAACAGAA AATAAACAAA TCTCATTCCG GAAAACGCTC ATAAATTGTC CGAAAGCCCT AAAAATCTGA  GTCTCGCATT AAGTCCAAAC ACTTTCATTT GTCTCCTTTC GTCAACTCCA CAGAGATCTC CTCATGGCTC CAATTGCTGT CGGCGATGTC GTACCAGACG GAACTATCTC CTTCTTCGAT  GAGAATGATC AACTTCAGAC CGCCTCCGTT CACTCTCTCG CCGCCGGTAA AAAAGTCATT CTCTTTGGTG TTCCTGGTGC TTTCACTCCC ACTTGCAGCA TGAAGCATGT TCCTGGGTTC  ATTGAGAAAG CAGAGGAGCT GAAGTCAAAG GGTGTTGATG AGATCATTTG CTTTAGCGTG AACGATCCGT TTGTGATGAA AGCATGGGGA AAAACATACC CAGAGAACAA ACATGTGAAG  TTTGTAGCTG ATGGGTCTGG AGAATACACA CACCTTCTCG GACTTGAGCT TGACCTTAAA GACAAGGGTC TTGGTGTTAG GTCAAGGAGA TTTGCTCTGT TACTTGATGA TCTCAAAGTG  ACTGTAGCCA ATGTCGAATC TGGTGGCGAA TTCACAGTTT CCAGCGCCGA TGATATCCTC AAGGCTCTCT AAGAAATGTA CCACTTGTGT TGTCTATGTA AACCGCTGTA TGTGTAGTAG  AGGATTCTAT AGCTTGTTCT CAGACATTAA CCAAGGTTGT AATAAAGCGG TTTCATTGTG ACTTGTTTGG CATAACAAAG TATTTGGTTT TGTTGTTTTT CTGTGCGTTG ATTAATGAAA 
GATGTGACTC ATTGACGTGA ACATTTATGC CAAATTTTGC CATTGTTGTT 

Retrieve as FASTA