Entry information : AtPrxII03 (At1g65970 / TPX2 / PRXIIC / PeroxiredoxinIIC / Thioredoxinreductase2C / AtPrxIIC)
Entry ID 4347
Creation 2007-01-18 (Christophe Dunand)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: AtPrxII03 (At1g65970 / TPX2 / PRXIIC / PeroxiredoxinIIC / Thioredoxinreductase2C / AtPrxIIC)
Name (synonym) AtPrxII03 (At1g65970 / TPX2 / PRXIIC / PeroxiredoxinIIC / Thioredoxinreductase2C / AtPrxIIC)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrxII03
start..stop
S start..stop
AlyPrxII03 328 1e-117 1..162 1..162
AtPrxII04 325 9e-117 1..162 1..162
AlyPrxII02 318 6e-114 1..162 1..162
AtPrxII02 316 4e-113 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24558075..24558229 155 N° 2 24557878..24557957 80 N° 3 24557527..24557780 254  
complement(join(24557527..24557780,24557878..24557957,24558075..24558229))


exon

Literature and cross-references AtPrxII03 (At1g65970 / TPX2 / PRXIIC / PeroxiredoxinIIC / Thioredoxinreductase2C / AtPrxIIC)
Literature Haas,B.J., Volfovsky,N., Town,C.D., Troukhan,M., Alexandrov,N., Feldmann,K.A., Flavell,R.B., White,O. and Salzberg,S.L. Full-length messenger RNA sequences greatly improve genome annotation Genome Biol. 3 (6), RESEARCH0029 (2002)
Protein ref. UniProtKB:   Q9SRZ4
DNA ref. Phytozome 11:   Chr1 (24558229..24557527)
Cluster/Prediction ref. Phytozome Gene 11:   19653389 UniGene:   At.66846
Omic ref. TAIR:   At1g65970
Protein sequence: AtPrxII03 (At1g65970 / TPX2 / PRXIIC / PeroxiredoxinIIC / Thioredoxinreductase2C / AtPrxIIC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17289.92  
PI (pH):   %s   5.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKAEELKSKGIDEIICFVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGLGIRSRRFALLLDNLKVTVANVESGGEFTVSSAEDILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 2 introns), 6 cDNA and 43 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCTATTATTA GATTCGTTTG GTAGTTGGTG TCCCTATTTG TAAATTGTAG AGTATACAAT TAGATCAGTT AGTGTATTTG GCTGAGTCTG CTTCTTGTGC AAATGTTTTG GCAGACGTTT  ATATATGCTG CTTGGTTTTA TAGTATTTAC GCCGTCATTT GGATCGATTG TTGCAGTGAA CTGTTCATCA TATGTATATG GTTTGATATC AGGTCTGTTC TTAGGTATAA CCTGTACTAT  TTCTGACCTT TGTGTTTGTG TCTACTTCTG AAATCTGATC TCTTGCTAGT CAAACATGTG AAAGCTAGGC TAATGGTAGT TGGTATTCAT AATAGTAAAT TGTAGAAGAG ATTCAGAGTA  TTGGTTAATG TATTTGGTTG AGTTTGCTTG ATGGTAGACT GATTCAAATG GTTTATGGCA TTGACGTTAT CACTTGGATT GATATGTTGC AGTGAACGAT CCGTTTGTGA TGAAAGCATG  GGGAAAAACA TACCCAGAGA ACAAACATGT GAAGTTTGTA GCTGATGGGT CTGGAGAATA CACACACCTT CTCGGACTTG AGCTTGACCT TAAAGACAAG GGTCTTGGTG TTAGGTCAAG  GAGATTTGCT CTGTTACTTG ATGATCTCAA AGTGACTGTA GCCAATGTCG AATCTGGTGG CGAATTCACA GTTTCCAGCG CCGATGATAT CCTCAAGGCT CTCTAAGAAA TGTACCACTT  GTGTTGTCTA TGTAAACCGC TGTATGTGTA GTAGAGGATT CTATAGCTTG TTCTCAGACA TTAACCAAGG TTGTAATAAA GCGGTTTCAT TGTGACTTGT TTGGCATAAC AAAGTATTTG  GTTTTGTTGT TTTTCTGTGC GTTGATTAAT GAAAGATGTG ACTCATTGAC GTGAACATTT ATGCCAAATT TTGCCATTGT TGTTCTTGAC TATGGTAGAC ACATACCAAA AAGTTAGGTT  ACCTGAGTTT CTGGTAAGTA TAGTTGCTAT ATTGCATTTA TAATGTACAT AGGCTTCTCA CACATTATCA AACTTTGGTA AGTTTGTCTC TATTTTTTTT ACCGCTCTAT CTTTTAGCCT  TGCTCATCGG ATATATATGT CCGATGACGC TTATCTTGAT TGTGTAAGCG TATGACCCTT TTTTTGTTTT GTGCGGTATC TAATGCTTAT CTTGATTGTG TAAGCGTATG ACCTTCTATT  TGTTTTGTGC GGTATTCAAT TCAACATGTT GAATTTGAAA ATAATAGTAA GAGAAGTACA AATTGCAAAT TATACTAAAT TGTTATAAGA TTGCAATTCA ATTTTAGCAT TTAGAGTGCT  TATTGAAATT AGAAAAGTAT AGGATCCGCG TGTTTATCAT ATGGGCGGGC TAGGATCAAA TAGGTCGAAT CACGAAATCA AATAATAACT AATCAGGTCT TAACAATGTT TTTACGATAG  ATTTAGTCTT AACCATTCAT TTTGTTTGGT ATGTAATTAA AAGCTAATCA AGGGCATATT CTCTCTCTAT TCGATTGTAT TCTCTAGAGA AACGATTTTC ATATATTTCC TAATCAAAAT  AGCATATTTG AATTATTAAT TTGTTTCCCT CAATAAGGTT ACGAATATGA TGCATTAATT TTGGATTTAA AAAATCTTGC TTGCTCACGA AGAAATCAGA CTCAATTTTT ATCGTCATAC  AATGTTTTCC AAAATATGTG TACATGTTCT TGCAGATGAG TCTATTAGTG AGGGTTACTT AAACAAAATG TTGTATTTTT GGAAAAAAAA GTTTATTTTT AGATATTGGT TCTAGATTTT  ACATCCAATT TTTGTTTTAA TCATAATTTT AGAAATTCTA TTATATTTTT TATGGTCAAA CTAAAATTAG AAATCTATTA ATGATTTACA TCATTCCGTA AAGCACTATA AATTGTCCTA 
AGGCCTAAAT ACATTTTCGC ACTCAAGTCA AACAAAACTC TTCTATTTTC CTCTGTCTTC AAAACCACAG AGATCTCTTC 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAACTTTAT CGTTTCGCTT GTTGTATTGT GAATCTAAAC TGCTGTATGT GAAGAAGAGA TTTCTATAGC TTGATTTCAA TCAACAAGCA TGTGTTTGAC TTGCTTGGCA TAATAAAGTA  TTTGATAAAC GTTCAATAAC AATGGCTTAA AATGAGTTTC AAGCGTATAT AATCCATAAT AACTGGATCA AATAGATATA CAAACACATA AACTGATAAA CGCAAAGTCC TCGCAAGTAC  CTCTTCATTT CCACACAAAG GCAACACACT TGCTTAGCAC ACACCATTCA TCTTCTTCCT CTCCTTCACA AACTTCCTCC ATCCAACAAT AACTTCCATC AGAATCTCCT TCTCCATCTT  CTTCTCCTTT ACATTTTCCG CGATCCCTTC TATTCCCATC TTCTTAGATA TCTTGGAAGG CAAGGTATCT AGCTCATGAA GCACCTTCGA AATATCAGCA ACAAGTCTCT CCGCGAGTGT  TCTTGAGAAA TCTTCCCTGA TGACAACACG CAGAACCGTG ATGTGCTGTG CATCGGCAGG CATAGTGTAA GCTGGGACGA TCCAGCCAAA ACGACGTAGC ATCTCAGAGA TCTCGAACTC  GTTGTGGAAA CTATGGTCCT TGAGAGAGAA GGCGACGACT GGCACTCCTT GGTCCTTTGA GACTATGTTG AAACGCTCTG TTTTCTCTAT ACCTTCTTTG AGAACCACCA TGTTCTCTAT  GCAATTCTCC ATCACATTTT TGTACCCCTA ATCAAATCAA ACATTCGATG TAACAAATAC CAGAGTCATA AACGTAACAA ACGAAAGAAA ATTGACATTA TAAATTGAAA ATGTAACAAA 
ACATATTTTC GGCTTAAATA GACTCACCTC GAATCCAAGA CGAATGAGCT GGTAGTATTG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCAATTACTGTCGGCGATGTTGTACCAGACGGAACTATCTCTTTCTTCGATGAAAATGATCAGCTTCAGACCGTCTCCGTTCACTCTATCGCCGCCGGTAAAAAAGTCATTCTC
TTTGGTGTTCCTGGTGCTTTCACTCCCACATGCAG
GTACAAACTACAAAGTCTCAAACGTTTTTAGATTTATCCTTTGCATTAGTTTTATAAGATGTGGGTTTTGTTGTTAGATTTGATT
TGAGAATTTTGTGTTGGTTTTTGTGAGGTTAGTATGAGCCATGTGCCTGGATTCATTGGGAAAGCAGAGGAGCTGAAGTCAAAGGGTATTGATGAGATCATTTGCTTTAGTGGTAAGTAT
GAATTGATATGTTTTTGATCTCTCCTCTGTTTTGGCCTCTATGAGTTTTTGTATACTTAGGCCATGAATGTTTGCATCTTTTGTTGCAGTGAATGATCCATTTGTGATGAAGGCATGGGG
AAAAACATATCCAGAGAACAAGCATGTGAAGTTTGTAGCAGATGGGTCTGGAGAATACACGCATCTTCTTGGACTTGAGCTTGACCTTAAGGACAAGGGTCTTGGTATTAGGTCAAGGAG
ATTCGCTTTGTTGCTTGATAACCTTAAGGTGACTGTAGCCAATGTTGAATCTGGTGGCGAGTTCACGGTTTCCAGCGCAGAGGATATTCTCAAGGCTCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCAATTACTGTCGGCGATGTTGTACCAGACGGAACTATCTCTTTCTTCGATGAAAATGATCAGCTTCAGACCGTCTCCGTTCACTCTATCGCCGCCGGTAAAAAAGTCATTCTC
TTTGGTGTTCCTGGTGCTTTCACTCCCACATGCAG
TATGAGCCATGTGCCTGGATTCATTGGGAAAGCAGAGGAGCTGAAGTCAAAGGGTATTGATGAGATCATTTGCTTTAGTGTGAAT
GATCCATTTGTGATGAAGGCATGGGGAAAAACATATCCAGAGAACAAGCATGTGAAGTTTGTAGCAGATGGGTCTGGAGAATACACGCATCTTCTTGGACTTGAGCTTGACCTTAAGGAC
AAGGGTCTTGGTATTAGGTCAAGGAGATTCGCTTTGTTGCTTGATAACCTTAAGGTGACTGTAGCCAATGTTGAATCTGGTGGCGAGTTCACGGTTTCCAGCGCAGAGGATATTCTCAAG
GCTCTTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATAAATTGTC CTAAGGCCTA AATACATTTT CGCACTCAAG TCAAACAAAA CTCTTCTATT TTCCTCTGTC TTCAAAACCA CAGAGATCTC TTCATGGCTC CAATTACTGT CGGCGATGTT  GTACCAGACG GAACTATCTC TTTCTTCGAT GAAAATGATC AGCTTCAGAC CGTCTCCGTT CACTCTATCG CCGCCGGTAA AAAAGTCATT CTCTTTGGTG TTCCTGGTGC TTTCACTCCC  ACATGCAGTA TGAGCCATGT GCCTGGATTC ATTGGGAAAG CAGAGGAGCT GAAGTCAAAG GGTATTGATG AGATCATTTG CTTTAGTGTG AATGATCCAT TTGTGATGAA GGCATGGGGA  AAAACATATC CAGAGAACAA GCATGTGAAG TTTGTAGCAG ATGGGTCTGG AGAATACACG CATCTTCTTG GACTTGAGCT TGACCTTAAG GACAAGGGTC TTGGTATTAG GTCAAGGAGA  TTCGCTTTGT TGCTTGATAA CCTTAAGGTG ACTGTAGCCA ATGTTGAATC TGGTGGCGAG TTCACGGTTT CCAGCGCAGA GGATATTCTC AAGGCTCTTT AAGAAACTTT ATCGTTTCGC  TTGTTGTATT GTGAATCTAA ACTGCTGTAT GTGAAGAAGA GATTTCTATA GCTTGATTTC AATCAACAAG CATGTGTTTG ACTTGCTTGG CATAATAAAG TATTTGATAA ACGTTCAATA 
ACAATGGCTT AAAATGA 

Retrieve as FASTA