Entry information : AtPrxII04 (At1g60740 / PRXIID / PeroxiredoxinIID / Thioredoxinreductase2D / AtPrxIID)
Entry ID 4355
Creation 2007-01-31 (Christophe Dunand)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: AtPrxII04 (At1g60740 / PRXIID / PeroxiredoxinIID / Thioredoxinreductase2D / AtPrxIID)
Name (synonym) AtPrxII04 (At1g60740 / PRXIID / PeroxiredoxinIID / Thioredoxinreductase2D / AtPrxIID)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrxII04
start..stop
S start..stop
AtPrxII03 325 9e-117 1..162 1..162
AlyPrxII03 324 3e-116 1..162 1..162
AlyPrxII02 314 2e-112 1..162 1..162
AtPrxII02 312 2e-111 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22361127..22361281 155 N° 2 22361386..22361465 80 N° 3 22361564..22361817 254  
join(22361127..22361281,22361386..22361465,22361564..22361817)


exon

Literature and cross-references AtPrxII04 (At1g60740 / PRXIID / PeroxiredoxinIID / Thioredoxinreductase2D / AtPrxIID)
Literature Verdoucq L., Vignols F., Jacquot J.-P., Chartier Y., Meyer Y.

"In vivo characterization of a thioredoxin H target protein defines a new peroxiredoxin family."

J. Biol. Chem. 274:19714-19722(1999).
Protein ref. UniProtKB:   O22711
DNA ref. Phytozome 11:   Chr1 (22361127..22361817)
Cluster/Prediction ref. Phytozome Gene 11:   19656756 UniGene:   At.48325
Omic ref. ePlant:   At1g60740 TAIR:   At1g60740
Other ref. GenBank:   AC002292 (85117..85807)
Protein sequence: AtPrxII04 (At1g60740 / PRXIID / PeroxiredoxinIID / Thioredoxinreductase2D / AtPrxIID)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17347.94  
PI (pH):   %s   5.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKAEELKSKGIDEIICFVNDPFVMKAWGKTYQENKHVKFVADGSGEYTHLLGLELDLKDKGLGIRSRRFALLLDNLKVTVANVENGGEFTVSSAEDILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 2 introns), 5 cDNA and 11 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAAAGAGAT TGTCAAGTTC AGCTAAAGTT GCTGGCTTTC AATATAGGTC ATGAAGTGTG AGCTCAGAGT CAAACCTAAA GGAGTCTATT CAAACGAAAA ATTCTAAGGG AGATGATAAG  ATCATTTCAC CAGACAATGG TTCTTCATGA ATAAGCTAGT AATTTCAGAA AGAGTGACCC AAGCAGAAAA CATAGTTCTG AAAGCTAAAC TCTTCGACTC TATATTAGTC CCAACATGTC  TCTAGCCACA TGTGTGAAGC TCACTGAGAA GTGAGAGGAA CTATATAACT TCCATTTCAT TTGAAAGTTG CAAAACCATG AAGGAAGATT GACAAGAAGA GTGCTTACAG TGATTTCGAT  AGGGACACGA GTATCAATTC GATGCTGATA ATAGAGATCA ATGCAGGCAA CATCTACTCG CATTAAACTA GCCTCACACG CAGCTCTTAC ATAAGCAGGA TCTCCCTTAA ACTCTACTTT  CCCCTCTGCA TACCTGATTC CATATTTGGT CGCAAGTTCC ACTTTTTCTC TCACCCCATC CTTGAGAGCC TGACAAAAAT CCAAACTTTC AACAAAAATC CAAACTTTCA ACATCCAAAT  CATTTATACA GCTCTGAAGC TCAGCGAATC AAGGCCAGTG TTCCCATATC ACAAGGCCAG TGTTCCCATA TCTAAATCAC GAACTCAAAT ATTAAAAAAT ATCAATATCA AAAGGGGAAT  TATCAAAATC GAACCTTGCT GAGGAGAAGC TCGTTGGTCT CAGGACCGTA GATATCGGAG GTGTCAAGGA AAGTGACGCC GGAGTGAATG GCGTGGTGGA TGAGAGCGAT AGCTTCGGTT  TCCGGCTTGG GAGTACCGTA GAAAGCAGAG AGACCCATGC AACCAAGACC TTGCGCCGAT ACCTCAAGGC CTTGGCTTCC TAGCTTAATC CTTCTCACTC CGCAAGCTTC CGCCATGAGT  CTCTGTCAGA AGTCAGAACT ATCTCTCTCT CTTGACTTGT CTAGGTGACT CTTATAGAGC TGTGAATTTA AATGGAGTTG GATTGGTGTG ATGGTGAAGA TAAATTCAGT GTCAATTTTG  GATGGCTGGT GCAGTTTTTT TTTTCCCTCT TAACGAAAAC AAAATTGAAT TTGTTAACCA AATAAAGTAA TGGAATCTTC ATAAGTCAAA CTCATTTTTG ATGTAGTTAA CCAAATAATG  TCTTCACTTT CTTTCTCAAT CAATTATTAA CTTCTTGTGA GAAATAAACT TTCCTAATAA TTTGTTCACG TATAAATGTT TTTTTAGGTT GAAAATTTGA AGTACAATTT TCTCTTATTA  GTTTTTGTTT TCAAGATATA TCTTTGAATT AATATTATAT AAAAACGCAG CATGTAGTAG TATAACATTT TGATCTTGAA AATAAAAAAA TATCAATTTC AAAGTCTTGA AAATAACCTT  TTTTTTTTTT GGCTATGAGT CTTGTGAAGT TAACTTGGTG AACTCTCGAC TCACGATGCA TATCTTAATT GAGCAACATG ATTCATAATT CATCTTTTCA TGTCTCTTGC CAACTTCCAA  TAGAGTGCAT TGACATTATT TTTTTAATAC ATTATACATA TATCATGCAT GTTTGTTTCT CATCCATGGA GAATCATTTT TGAAATTTTT GGATTTTTGA AATTGCTTAA AAAGAAAGAA  AAAAACTCAA TTTTTATTGT CATACAATGT TTTCCAAAAT ATGTGTACAT GTTCTTGCAT ATGAGTTAAT TAGTGAGGGT TTCCTCAAAA AGATTGTTGT ATTTTTGGAA AACAAAGTTT  ATTTTTGGAT ATTGGTTCTG CATTTTACAT CTAATTTGTT TTTTAAATCA TAATTTTAGA AAATCTATTA CTAAATTAAG AAATCTATGA ATGGTTTACT TCATTCCGTA AAACACTATA 
AATTGTCCTA AACTCATATT CGCTCTCAAG TCAAAACTCT TCTATTTTCC CCTGTCTTCA TATCCAACAG AGATCTCTTC 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAACATTAT CATTCGCTTG TTGTATTGTG AATCTAAACC GCTGTATGTG AAGAAGAGAA TTATATAGCC TGATTTCAAT CAACAAGCAA GTGTATTGAC TTGCTTGGCA TAATAAAGTA  TTTGGTTTTA ATGTTTTTCT TTGCGTTGAT TCATGAAAGA TATGAGTACT TAAAATGAGT TGCAACCTTA TAGAAATCCA CAATAACTGG CTCAAATAGA GATACGAACA CAGAAACGCA  AAGTCCTCAC AAGTACCTCT TTAATATAGA GTCTTTATTA ACAAACAAAC ACAAAGTAAA CTTGCTTTGT ACAAAACCTT TATTCTTTCT AAGGCATTAT TGGCTCTTTC TTATTGCAAA  CTCGCACACC TATATACTTA ACTTATTTCA CACACACAGA GATACATCTT CAGCACAATT TTACCGCGAT TTGGCGAATG CGGTATACCC TCAAAACAGT TTCCAAACAT GTATTTTATC  TTGCTTTCCA AGAAGACAAT GGTGGAGTCT CTGAGTCTTT GTAAGTAACC ATGTTGTTGT CATACCGTTC ACCTTTCACG AAATCCGGTT GAGCAATGGC TTCAAGCTCA ACCATCTCTT  CAGGAGTGAG CTTCACGGAT AAAGCTCCAA TGTTTTGGTT GAGGTTTTGG ATCTTGGAGG TTCCTGGAAT TGGACATACA TCATCTCCTT GATGGTGAAC CCACGCTAGA GCTAGTTGTG  CAGGAGTGCA ACTTTTCTTT GTCGCCATCG CTTGGACTTT CTCGTAGAGA ATCTTGTTGT TTTCTAGATT CTCCTGTTGG AATCTTGGTA AACCCTGTGA CAGAGTAGTA TCAAGAAGCA  TGAGATGACT CCAAATCTTG AAATATGCTT TAAAGAACTC ATATACAATG TATGTATACG GAAACAGAGA ACTGAATCAA TCATGCACTT GGCTTTCGAT AATCATCTTG CTCTAGATTC 
TCAACAATCT TGGTCCGGAT GCTAAGAAGC CTCTTCCTAG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCAATTACTGTCGGCGATGTTGTACCAGACGGAACTATCTCTTTCTTCGATGAAAATGATCAGCTTCAGACCGTCTCTGTTCACTCTATCGCCGCCGGTAAAAAAGTCATTCTC
TTTGGTGTTCCTGGTGCTTTCACTCCCACATGCAG
GTACAAAGTTTCAAACGCTTTTTCAGATTTATCCTTTGATGCTAAGCTGATGGATTCTTAGATTTTGATTTGAGAATTGGCGTTT
TTGGTTTTTCTGAGGTTAGCATGAGCCATGTGCCTGGATTCATTGGGAAAGCAGAGGAGCTGAAGTCAAAGGGTATCGATGAGATCATTTGCTTTAGTGGTAAGTATGAATATTGATATG
TTTTGGATCTCTACTCTATTCTTGCCTCTATGAGTTTGTGTATAGTGACCAAAAAATGTTGAATGCATTTGTTGCAGTGAATGATCCATTTGTGATGAAGGCATGGGGAAAGACATACCA
AGAGAACAAGCATGTGAAGTTTGTAGCAGATGGGTCTGGAGAATACACACATCTTCTTGGACTTGAGCTTGATCTCAAGGACAAGGGTCTTGGTATTAGGTCAAGGAGATTTGCTCTGTT
GCTTGATAACCTTAAGGTAACTGTAGCCAATGTCGAAAATGGTGGCGAGTTCACGGTTTCCAGCGCAGAGGATATCCTTAAGGCTCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCAATTACTGTCGGCGATGTTGTACCAGACGGAACTATCTCTTTCTTCGATGAAAATGATCAGCTTCAGACCGTCTCTGTTCACTCTATCGCCGCCGGTAAAAAAGTCATTCTC
TTTGGTGTTCCTGGTGCTTTCACTCCCACATGCAG
CATGAGCCATGTGCCTGGATTCATTGGGAAAGCAGAGGAGCTGAAGTCAAAGGGTATCGATGAGATCATTTGCTTTAGTGTGAAT
GATCCATTTGTGATGAAGGCATGGGGAAAGACATACCAAGAGAACAAGCATGTGAAGTTTGTAGCAGATGGGTCTGGAGAATACACACATCTTCTTGGACTTGAGCTTGATCTCAAGGAC
AAGGGTCTTGGTATTAGGTCAAGGAGATTTGCTCTGTTGCTTGATAACCTTAAGGTAACTGTAGCCAATGTCGAAAATGGTGGCGAGTTCACGGTTTCCAGCGCAGAGGATATCCTTAAG
GCTCTCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGTCAAAAC TCTTCTATTT TCCCCTGTCT TCATATCCAA CAGAGATCTC TTCATGGCTC CAATTACTGT CGGCGATGTT GTACCAGACG GAACTATCTC TTTCTTCGAT GAAAATGATC  AGCTTCAGAC CGTCTCTGTT CACTCTATCG CCGCCGGTAA AAAAGTCATT CTCTTTGGTG TTCCTGGTGC TTTCACTCCC ACATGCAGCA TGAGCCATGT GCCTGGATTC ATTGGGAAAG  CAGAGGAGCT GAAGTCAAAG GGTATCGATG AGATCATTTG CTTTAGTGTG AATGATCCAT TTGTGATGAA GGCATGGGGA AAGACATACC AAGAGAACAA GCATGTGAAG TTTGTAGCAG  ATGGGTCTGG AGAATACACA CATCTTCTTG GACTTGAGCT TGATCTCAAG GACAAGGGTC TTGGTATTAG GTCAAGGAGA TTTGCTCTGT TGCTTGATAA CCTTAAGGTA ACTGTAGCCA  ATGTCGAAAA TGGTGGCGAG TTCACGGTTT CCAGCGCAGA GGATATCCTT AAGGCTCTCT AAGAAACATT ATCATTCGCT TGTTGTATTG TGAATCTAAA CCGCTGTATG TGAAGAAGAG 
AATTATATAG CCTGATTTCA ATCAACAAGC AAGTGTATTG ACTTGCTTGG CATAATAAAG TATTTGGTTT TAATGTT 

Retrieve as FASTA