Entry information : At2CysPrx01 (At3g11630 / BAS1 / At2CysPrxA)
Entry ID 4358
Creation 2007-01-18 (Christophe Dunand)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: At2CysPrx01 (At3g11630 / BAS1 / At2CysPrxA)
Name (synonym) At2CysPrx01 (At3g11630 / BAS1 / At2CysPrxA)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Buds
Inflorescences
Mixed tissues
Seeds
Siliques
Stems
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value At2CysPrx01
start..stop
S start..stop
Aly2CysPrx01 460 1e-166 1..266 1..265
So2CysPrx 459 2e-166 1..266 1..265
Bn2CysPrxB-2_other 442 9e-160 1..266 1..262
Br2CysPrx02_other 437 1e-157 1..266 1..268
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3672189..3672395 207 N° 2 3672779..3672853 75 N° 3 3673015..3673096 82 N° 4 3673192..3673271 80
N° 5 3673396..3673521 126 N° 6 3673616..3673729 114 N° 7 3673821..3673937 117  
join(3672189..3672395,3672779..3672853,3673015..3673096,3673192..3673271,3673396 ..3673521,3673616..3673729,3673821..3673937)


exon

Literature and cross-references At2CysPrx01 (At3g11630 / BAS1 / At2CysPrxA)
Literature Baier M., Dietz K.-J. 2-Cys peroxiredoxin bas1 from Arabidopsis thaliana.
Protein ref. UniProtKB:   Q96291   Q8L5U1 [Mismatch]
DNA ref. Phytozome 11:   Chr3 (3672189..3673937)
Cluster/Prediction ref. Phytozome Gene 11:   19661864 UniGene:   At.22950
Omic ref. ePlant:   At3g11630 TAIR:   At3g11630
Protein sequence: At2CysPrx01 (At3g11630 / BAS1 / At2CysPrxA)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   267
PWM (Da):   %s   29073.96  
PI (pH):   %s   7.57
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASVASSTTLISSPSSRVFPAKSSLSSPSVSFLRTLSSPSASASLRSGFARRSSLSSTSRRSFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic, 9 cDNA and 166 ESTs. Two TREMBL accessions Q96291 and Q8L5U1 (3 mismatches).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATGGCCATC TTCAAGTCTT TATACAACTA GGTTCAAGTG TAAAACCCAA GAAAATCAGT GAATATGAGA TAATCAATAC CTGCCTCAAG TGAGTGCAGG TAGCTTGAAC AGCAGTATCA  GACCATGAAG CTCCAATGGA TTTAGATACA AGCAGCCGTG CAGCTGACAT AGGTAAAAGT CTCAGCGATG CAATCAGAAA ACTTGCTGTA GCCGACAGAA CAGAAGACCT GCACAACATG  ATAACGATTT CACAACATTC TAAATAAAGA CTGATTGGTT CTTTCCTATC GAGGATTCGT ATTGAGAACA AAAGCTCACG CTGCAAGTTT GCCAATTAAT GATTGCTTTG TTGATTGTTG  GTTCAAAGTC AAAAATGGAT ATAGGCCAAT GCAATATACC ACCTGCAAAG CATTCCAGAG AATAATATAA GAAAAATCAC ATAGCACTGA AAGAAATTGT GATGGAGAAA GTACTACTCT  TAGAGGAAGC CATCTATACC TTGTCCGAGA ATTTCTTCAA TAACTCAAGG GATATATAAG ACCCAATAGA ATGCCCAACC TACCAAGATC AATTAAGCTT AGAGTTGTAA ATTTTCATGA  AAATCTGGAA ATCCATCCAA CTAATGGACA TATATATTTT GGTCATAAGA AGCAATATGT CAATGGCTTA TACACATGAC AGTCTTACCA ATATTATTGG AACTTTCACA CTCTCCAACT  CCTGTCTGAT AAAATCAATC TGTATGATAA CTAACAGATT AAGATCTTAA CTTCACAGGA TGAACAATAC AAGAACCTAA AGGCTTTCAA ATCCAAGAGC AATGAAGAAA AATGATTTTT  ATTACCTTAT GATCAATTTG TTCTTGAAAT GAAAATAGCC TCCCAGACTC CCAGTCCTAA AAGTGAAAAT AATCAAGTAT CATGAAAGCC TATCAAACTA AGATATTATA TGAAGAGAAC  CATCAAAGTT TACACACAGT AAAACCTGAA ACCAAAGTTA ACGTACCTTG CTCGTGTGAG ATATTTGCCC AATAGCTACA CAAATAAAAC AAACCACTCC ACCATTAGAG ATCAGAAGAA  CAAACTCAAA CTCAGAAATA AACAGCTTCC ATCTTAAGGA CTCAAAGAAA TCAAACTCGA AAAGTAGAGC AGCCATACCA ATTACAGAAG CATTTCCACC AAGAAACTCG TATAAAGATT  CCAAAAAGTC CTTGTAAAAT GACACAACTC CTGAAAAATT ACAAGCCAAT GTATGAAGCA CACTAGTATA TACACGTGCA TGCATAAGAG TCTTGAGCAT AATAATGAAA CCTGGATTTC  CCGGAATAAA CAATACATGG AATGTGGGAT TCTCAGCTTG AATTTCCATC ATCTCCGTCA TCGAACTTTG ATCACAAATA CAAAAAACAA AACAAAAAGT GTAACTATAG TCAAAGAAAT  TAGAAAATTT CGTAAAAGAT TAATGTAACA ATACCCAGAA ACTCTGCACA ATCTGGATTT AACATGTCTT TTAGTTTCAT TCATCAATTT GTTTTGAGTC TCCATGTCTC CGGTCACGCG  ATTCAACTTA TATCTTCTCT CAGAACTGTC AACACTTGAA AGGAGAAGAT CGAGAGAATT AATGAGACAA CAGAGAAACC ACTAAAAATC AAAACTTTGC AAAATAAGTG AAGAAGCCTT  TTAAAGTAAA CCAAGTGAAG AGAGCACAAC AATGCACCTG AAACAACAGG AGTAGATTAG ATACTTTGGA GAACTGAACC ACCGATCGGA GGAAGAAAGT AACGGAGAGA CGGAGTTACC  CAAGGTAGAA GAAGAAGACG CATATTTGCA GCAATAGTAA TACGACCTCG TTTTGAGTAA CGCGACGTCG TTTTATGAGT TTGGGTGTCG TCAGGCTTAT CTCCACCTCA TACTTCCACT 
ACAAAGAGAG GTGATTGACA GATAGATAAG AGTGTTTGGT AGCTCAGACT CAGAGAGTCA CAAAGTGTGT GTAGCAGCA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAACTCTACT ATGATAGCAA AAAGGTACAA TCTTTGTTAT ATGTGAGCAG AGTTTTTTTT CTTGTACGCT AAAACAATCC TTTGTTTGAT TCTCACTTTG TCCCCAAAAT TATAATAAAA  AACTTTTTCC GTTAATGGAA GTCTTATTGT GTTACGCCTA CAAATTCATA TTCAGTTGAT CACTTACCTA AGCATGTACA CTGTACATAT TAATGGTAAA AATCAAGACC ATTTTGTGAT  CTTCTTTGAT AGCACAGAGA AGCCATTGTT CTACCATATA CGCTAGTCAT ATTAAAGGAC CTGTAAAAAA ACCAAAGGAC AGAAATTATA AAACTATCAT TTCTCTTTCT TTAATGCATC  TATATGATAA TTATGATCCT TAAAAAGCTG ATGCTACCTG TAAAAAAGTT GCTCATGTGT CCCCCTGCCA ACAAATTCCA ACATCATTAA TCATCATCAA CCCAACCTCC TCCGTCAACT  GATGACCGGT AAACGCCGGT CAACTCTCCT GCTTTAACTA CACTACGTCC CGGTCATTAT TTTTTCACAC TCTCTCTCAA ACGATGCATG CCCTCACCAA CTCCGGCGCC GTACTTCTCG  CCGTGTTACT CTTCTTTCTG CTCATCCTTT TCGCCGAGCT CTCTTACATC TTTTGTTGCC GCACCGGATC TTTACCGTCT CCGGCAAGTA AAGAGGTTCT TTTCCAATTC TTGATGTGTT  GCAAGAAGAA TCACCACCAC TCTCGTATTG AGCCATGCAC CGGTATTGTT TCTGTACAGA TGGAGGAGGA TGTTGTTGCT GCGGCGGTGC CTGAGGAGGA ATTCGCGGCG GCGGACAAGT  GGCGGGTGTC GAGGCTTCTC TTCACAATTG AAGAAGAGGA TTTGGAACTG GAAGATGATG ATGATGATGT GATCTCTGCG GAGGTAGATA ATGGCTTCGA AGTCCAAGTT GATATTCCGG 
TGGAGTATTC CGGCGATCCA ACTCCGTTCT TGACGCCGTG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTGTTGCTTCTTCAACTACTCTCATCTCTTCTCCCTCTTCTAGGGTTTTTCCAGCAAAGTCTTCACTTTCCTCTCCATCTGTTTCTTTCCTTCGAACCCTTTCTTCTCCTTCC
GCATCTGCTTCTCTCCGCTCCGGATTTGCTCGACGCTCTTCCCTCAGCTCCACTTCTCGTCGGAGCTTTGCTGTCAAAGCCCAGGCC
GTAAGTTTATCTAAATGTCGATACTTTTCTTAT
TCGATGTCATTGAAATCTGAATTCATTAGCCTGTTATAGATTTCACTCTCTTCCTACTTGTTAGCCCTATAGGTTTTGGGGAAATAGTTAACGATTTATAGGTTATGCGACCGTGTTTCT
GCAGATTACTCGAAAAGTTCAGAAATTTGAGTGACATTTTCGTTTAGGGTTGTTAATTTCTCTGGTGAAGTGAAATTGAGTGACATATGAGCTATACTCATTGACTGATTAGTATGTTCG
GATGAGGTCTATGTAGTTTTGGTATAGTACCATGGTTATCTGATTGTCAATTTGACTGATCTTTCTCCTTAGATTTGATGTGTTAACGAGTTTTAATTTGGTGATTATAGGATGATCTTC
CACTGGTTGGAAACAAGGCGCCTGATTTTGAGGCAGAGGCTGTGTTTGATCAAGAGTTCATCAAG
GTACTTACAGCAGTTATCAATCACAGTTGCTGCTTCTAGTTAATCTGAGATTAAG
TTTAGTTTTGAAGCTGAATGAGTAGTCTTTAGTGTTTTTTATTTAGTGAGTATATGTCTTATTGTGATTGGAAACTAATTGGTAACTGATGAATGTATGGTTTCAGGTTAAGCTCTCTGA
TTACATTGGAAAGAAGTATGTGATTCTCTTTTTCTACCCATTGGACTTTACTTTCGTCTGCCCAACAG
GTTAGCATTGCTCGAGAAGTATATCAAAATTGAATATCCAAGGTTCCCTCAT
CCTTGAGTCCTAATCTTTCTCATTTTTTCCTTATGTCTTTTAGAGATTACTGCCTTCAGTGACCGGCATTCAGAATTTGAGAAGTTGAACACCGAAGTATTAGGTGTTTCTGTCGATAGT
GTG
GTAAGTATCACTATACATTTACTATGTTCTCATTTTACTCAGTTCCTCATCCTTGGTTGACATCACCATGTTCTTATCTGTTTGCAAATTTTTGATTCATTCTTATTTCTGTGTGTC
CTCGTAGTTCTCTCACCTTGCATGGGTCCAAACAGACAGGAAATCTGGAGGGCTTGGTGATCTGAACTATCCCCTTATTTCAGATGTCACTAAATCAATCTCAAAGTCGTTCGGAGTGCT
CATCCATGATCAG
GTAATTGTTAGCCTTTAAATCTTGGCTACCTTCCTTTAAACTTTCGAAGTGTTTGGGATAAATGAAAACAAGAACTTTGTTTGTGTAAGAACAGGGAATAGCACTGA
GAGGACTTTTCATAATCGACAAGGAAGGAGTGATCCAACATTCCACCATCAACAATCTTGGTATTGGCCGAAGCGTTGATGAGACAATGAGAACCCTCCAG
GTAAAGATACAAATAAATA
CACACAACTCCAAAAACCGCTCTTTCCTTTCACTCGATTTCCGGTATGCTTAATACGTTTTCAATGTTGCAGGCATTACAGTACATCCAGGAAAACCCGGATGAAGTCTGCCCAGCAGGA
TGGAAGCCGGGTGAGAAGTCAATGAAACCCGACCCAAAACTCAGCAAAGAGTACTTCTCAGCTATTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTGTTGCTTCTTCAACTACTCTCATCTCTTCTCCCTCTTCTAGGGTTTTTCCAGCAAAGTCTTCACTTTCCTCTCCATCTGTTTCTTTCCTTCGAACCCTTTCTTCTCCTTCC
GCATCTGCTTCTCTCCGCTCCGGATTTGCTCGACGCTCTTCCCTCAGCTCCACTTCTCGTCGGAGCTTTGCTGTCAAAGCCCAGGCC
GATGATCTTCCACTGGTTGGAAACAAGGCGCCT
GATTTTGAGGCAGAGGCTGTGTTTGATCAAGAGTTCATCAAG
GTTAAGCTCTCTGATTACATTGGAAAGAAGTATGTGATTCTCTTTTTCTACCCATTGGACTTTACTTTCGTCTGCCCA
ACAG
AGATTACTGCCTTCAGTGACCGGCATTCAGAATTTGAGAAGTTGAACACCGAAGTATTAGGTGTTTCTGTCGATAGTGTGTTCTCTCACCTTGCATGGGTCCAAACAGACAGGAAA
TCTGGAGGGCTTGGTGATCTGAACTATCCCCTTATTTCAGATGTCACTAAATCAATCTCAAAGTCGTTCGGAGTGCTCATCCATGATCAG
GGAATAGCACTGAGAGGACTTTTCATAATC
GACAAGGAAGGAGTGATCCAACATTCCACCATCAACAATCTTGGTATTGGCCGAAGCGTTGATGAGACAATGAGAACCCTCCAG
GCATTACAGTACATCCAGGAAAACCCGGATGAAGTC
TGCCCAGCAGGATGGAAGCCGGGTGAGAAGTCAATGAAACCCGACCCAAAACTCAGCAAAGAGTACTTCTCAGCTATTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTGATTGACA GATAGATAAG AGTGTTTGGT AGCTCAGACT CAGAGAGTCA CAAAGTGTGT GTAGCAGCAA TGGCGTCTGT TGCTTCTTCA ACTACTCTCA TCTCTTCTCC CTCTTCTAGG  GTTTTTCCAG CAAAGTCTTC ACTTTCCTCT CCATCTGTTT CTTTCCTTCG AACCCTTTCT TCTCCTTCCG CATCTGCTTC TCTCCGCTCC GGATTTGCTC GACGCTCTTC CCTCAGCTCC  ACTTCTCGTC GGAGCTTTGC TGTCAAAGCC CAGGCCGATG ATCTTCCACT GGTTGGAAAC AAGGCGCCTG ATTTTGAGGC AGAGGCTGTG TTTGATCAAG AGTTCATCAA GGTTAAGCTC  TCTGATTACA TTGGAAAGAA GTATGTGATT CTCTTTTTCT ACCCATTGGA CTTTACTTTC GTCTGCCCAA CAGAGATTAC TGCCTTCAGT GACCGGCATT CAGAATTTGA GAAGTTGAAC  ACCGAAGTAT TAGGTGTTTC TGTCGATAGT GTGTTCTCTC ACCTTGCATG GGTCCAAACA GACAGGAAAT CTGGAGGGCT TGGTGATCTG AACTATCCCC TTATTTCAGA TGTCACTAAA  TCAATCTCAA AGTCGTTCGG AGTGCTCATC CATGATCAGG GAATAGCACT GAGAGGACTT TTCATAATCG ACAAGGAAGG AGTGATCCAA CATTCCACCA TCAACAATCT TGGTATTGGC  CGAAGCGTTG ATGAGACAAT GAGAACCCTC CAGGCATTAC AGTACATCCA GGAAAACCCG GATGAAGTCT GCCCAGCAGG ATGGAAGCCG GGTGAGAAGT CAATGAAACC CGACCCAAAA  CTCAGCAAAG AGTACTTCTC AGCTATTTAG AAACTCTACT ATGATAGCAA AAAGGTACAA TCTTTGTTAT ATGTGAGCAG AGTTTTTTTT CTTGTACGCT AAAACAATCC TTTGTTTGAT 
TCTCACTTTG TCCCCAAAAT TATAATAAAA AACTTTTTCC GTTAATGG 

Retrieve as FASTA