Entry information : At2CysPrx02 (At5g06290 / At2CysPrxB / 2CPB)
Entry ID 4361
Creation 2007-01-19 (Christophe Dunand)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-09 (Achraf Jemmat)
Peroxidase information: At2CysPrx02 (At5g06290 / At2CysPrxB / 2CPB)
Name (synonym) At2CysPrx02 (At5g06290 / At2CysPrxB / 2CPB)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Inflorescences
Mixed tissues
Roots
Siliques
Stems
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value At2CysPrx02
start..stop
S start..stop
Aly2CysPrx 458 1e-165 3..273 1..264
Thas2CysPrx02 446 2e-160 27..273 28..278
Bn2CysPrxB-2_other 442 2e-159 3..273 1..262
Bn2CysPrxB-1_other 439 5e-158 3..273 1..270
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1919380..1919607 228 N° 2 1920008..1920082 75 N° 3 1920200..1920281 82 N° 4 1920371..1920450 80
N° 5 1920625..1920750 126 N° 6 1920870..1920983 114 N° 7 1921095..1921211 117  
join(1919380..1919607,1920008..1920082,1920200..1920281,1920371..1920450,1920625 ..1920750,1920870..1920983,1921095..1921211)


exon

Literature and cross-references At2CysPrx02 (At5g06290 / At2CysPrxB / 2CPB)
Literature Asamizu,E., Nakamura,Y., Sato,S. and Tabata,S.

A large scale analysis of cDNA in Arabidopsis thaliana: Generation
of 12,028 non-redundant expressed sequence tags from normalized and
size-selected cDNA libraries

DNA Res. 7 (3), 175-180 (2000)
Protein ref. UniProtKB:   Q9FED5   Q9FNH9   Q8LEA5 [Mismatch]   Q9C5R8 [Mismatch]
DNA ref. Phytozome 11:   Chr5 (1919380..1921211)
Cluster/Prediction ref. Phytozome Gene 11:   19666700 UniGene:   At.7277
Omic ref. TAIR:   At5g06290
Protein sequence: At2CysPrx02 (At5g06290 / At2CysPrxB / 2CPB)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   273
PWM (Da):   %s   29648.16  
PI (pH):   %s   5.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSMASIASSSSTTLLSSSRVLLPSKSSLLSPTVSFPRIIPSSSASSSSLCSGFSSLGSLTTNRSASRRNFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns), 9 cDNA and 86 ESTs. Four SwissProt/TREMBL accessions: Q9FED5, Q9FNH9, Q9C5R8 (1 mismatch), Q8LEA5 (1 mismatch).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAAGGGTATC TTATTCTCAT AACCATCTTA TCAAAAATCC GAATTTGATT TGTAGGATCT TGGTGGCTCT TCTTACTGTT TTCGAAAGGA TAGGAGACAT CATTGTATCA TGGTTAGTAC  TTATATGTCA AACTTCAAAT CTCCATCATA TGCTTCTTTA TTGTATGAAA CCTTCTGATT CATCTCATCT ATCCGCAGGT TACCACTCTA CGGAGAGATC AAAATCGCTC TTCTCATCTA  CTTATGTTAC CCGAAATCAC AGGTACTAAC TACAGTACAA TGCAATAAAA ATCTAATGAG AATTCATTCT CATTCTTAGA TTCACAAAAC GACCAATCTT CTTCTCTTGG TTTCTAACAG  GGACTTAGCT ATGTCTACGA GAAGCTACTA TGTCCATACA TGTCAAAACA TGAATCTGAC ATCGATCAAG GAATCTCTGT CTTAAAGATA AGAGGACATT TAGTAATTGC TCAACTACTG  CAATGTATCT TCCACTGGAG CCTCCAAATC TTCAAGCAAT TGCAACAACA ATTCACCATC TATAAGGTAT TCAAAACAAA CATATACATC CTCAAGCTTT ACTGCATCAG AGCACTCTCA  CCAAATCCAT CACTTCCTTT GTCTACAGAA TAAAAACCAA TCAAAGTCAA AAGATCAACA ACAAACAAGA ACTTCTTTAA TGTTTCTCCG TTAGAAGGTG CCTGCTATAC TACTCTAAGC  CACAATCTCA ATAACCGGGT TTTTAAACCG CCGGTTAACC GGAGTTTCAC ATGACTTCAA ATTGACCACA GACGAACAAA AAAAAAAAGA TTTTTCCTTT GATATGTTTT GAATATTGTA  ACACTTTATT GTATACAATT CAATTCATGA AAAATCCAAT TTTCTCACCA AATCAAAGTT TATTTGACAA TCAAAGGAAC ACGAAACGAT TGAAAAATCC AATCAAACAC ACGTCGCAAG  AACTGAAACC CGGCGGATAA GTGAAGCCAA ACGCGGCGGA AGAATTGAGA ACCAGCAGAA TCATCTGACG AAGTAAGCAC CGTTGGTTGA AGATAAGACA AAGCAGCTTG CTTAACGAGA  CGGTTACGAA TCGAGATATC TCCGGCGGCG GTGGATATAA CAGGAGAGCA GCTACCGTTG ATCGACGGTA AATTGAGTGA AGAGTTAATC GGAGAAGAGA TGATATCTCT GAGAGAAGTG  TAAGCTACGA AAGAGGATGG TTTTACGGAG ATGAGCTCGT AATCGAACGA AGACGGCGGC GTTGAAGCTA TGTCGAAAGG AACTTCTGGA GGAGTTAGAG TCGTCATGTT GGATATGGAT  TTTGTACGGC GGAGTTGAGT CGCCGGAGAT TGTGACGGCG GAATCTCCAT AGTCTTTCTT CTTCTTTTTT TTTGTTTGGT TTGTTTGTGA GTTTGTGGCT GATTGGGTTT TGCGAGTGTT  TAAAGTAAGG AAGGAGGTCC AATTATTGAT CTCTATGATA TGTACATTTG TCACTATCTT GTGTTGTATT AATTAGTAAA GAGATACGTT TACTTTATTT GTATTTTCTT AATTATTATG  ATTGGAATGG AAGATAGTAG GCAAATTACA AAATTTAAGG ATTGATTACT ATTTTTGATG TGAAGATTAG ATGGAAATAT ATTCGGAAAT CCAACCAGCC TAAAAATAGA TTTTGATTTA  ATTATCAAAG TATGATCATC AACACGGTGT CGTTCCGGTT CATCGAACAT TCCACTTCTT TCTTCTTGTC TGAAAAATCT AGAAGAGCAG CTATTTGGTT TCTCTATCCG ATTCGTCTCT 
CTCACGCCCT CACGTTTATC CACCTCATCC TCAAACCAAA CCACAAGACC TCTTTTTTAA GTAACCAATC ACAGAGAGAT AGAGAGAGAG AACAGAGTCA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGCTAAGAT TGAACACATG TTTGGTGAAA ATTAGCAATC AGAGTTGTTT TATTCGTCTT TTCAAAGTTG GAGCAGAGTT GTTATTTTTA GCCAAAGAAC CTTTGTATCT ATCTCATCTT  TCTCCTGTTT CTGCTATGTG ATTCTCCTTA AATTGAATCA AAAATAAAGA AATCCTTCTT TTCTTTTGCC AATATTTATG TCTTTCACTT GTGTAAATAG TTTATAATAA TGCAAAGAGG  CAGAGTATTT TGACCATTGC AAAAAATAAA TTAGAAAAAT ATCATGTGAG GTCACAGCTC CCTGGAATTA GATAACTATC TGATTGATTT GTTTAATAAA CTTGAGTGCT CATTAAGCTA  ATCTCCATCT GTAGCCGACA ACAAAATTAT GTTGTGGTAT TACTCGGAAT ATTCTCCACT CGGATTAATT AAAAAATATC GTACATGATA ATTTTCTGGT TAAATAAAAA TCTGATACCT  TTGACACGAG AAAAAAGTTA AAAACTAGAA GTTATGGATA AAATCAGAAA ATAACCAAAA GAAAAGGATC GTTTTGTCAT TTCTTGAAAA TAGCCCTATC CTTTTTTTCC ATTAAACCAA  AATGTACAAA GACAAGTGGG GAGTGATAGG GTTTGGTATA TACGCGGTTA GCAGTTACCC ACATGGTTTA TCCACTTCAC ACATTTAAAC CACCCCTACA AAATAATGTT TATCAAAACG  ACCCCAATAC TTTCTTTTGT CTTCTTTCCG CCCTTACCTT CTGATGTTAA ACAACTTAAT TTCCGCTGTA CACTGCTTTT ACCAAAAAAT AAACTCCCCA TAATACATCC TTACGTAGCG  GTAGCTACCT CCGAACCCGG TACATAACTT ATCCGGTCCA CTTCATCCCA AACCAATTTT GATGTTATCT CATCAAACTC CGGTTCATAT TCCTATAACA TCATTTTTAG AGTACGTACC 
ATCAACAAAT GAACCATGTA TCGAATGTCT TATATTGGCA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAATGGCGTCTATAGCTTCTTCTTCTTCCACCACCCTACTCTCTTCCTCTAGGGTTCTTCTTCCCTCCAAGTCTTCTCTTTTATCTCCTACCGTCTCTTTCCCCAGAATCATACCC
TCTTCCTCGGCATCATCCTCTTCTCTCTGTTCCGGGTTCTCCAGTCTCGGTTCCCTCACCACCAACCGCTCCGCCTCACGCCGGAACTTCGCCGTCAAGGCTCAGGCT
GTAAGTTGACTC
GCAATGCCATAAATTTCTTGTATTTGCTCCATCTTCTCATTCACTATGATTGTTGTATGAATTCGTTAGCTTGTTATAATGGGATCCGTACTATTTTCCTGCTTCTTATCTCTTAAGGGT
TTTGAGATCATTGGATAAAAGACTAAACTTTAAACTTTTTAGAGTTCTGCGATTTGAATTGAGCGACATTTTTGTTACCCTTCTTTCGGGTTTAATTAGGGATGGGAGGAAATGATCTGA
AATTAATTAATATGATTCACATTTGGCTCATACACAGAAATCTTTTGAGCCCTGCATAGATAGTGAACACCAGTTAAAGAACATTTTGTGTGGTTAAACAATTCGATGATCGATGACTGA
CTAGTGTTTATATGTTTTATGAATGCAGGATGATTTACCACTGGTCGGTAATAAGGCGCCTGATTTTGAAGCTGAGGCAGTTTTTGATCAAGAGTTCATAAAGGTACTTTCATTCCATTC
AAACCTTATTTAACATGTTAGTTAGTTAAGTGTCATAAGCTAAGGTCAATGCAGTAGAGCAATGTTCTGATAGTAATCGACCTATGAATCATGGTTTCAGGTGAAGCTCTCTGAGTACAT
TGGCAAAAAGTATGTTATTCTATTCTTCTACCCTTTGGACTTCACTTTTGTCTGCCCCACTG
GTTAGTATTCTGCTAAGGAAATAGCTTCAAAACTGAAACTCTCGCCCTCATAGTCACT
GAAATTTCCAATTTTTCTTTGCTTATTCTAGAGATTACTGCCTTCAGTGACCGTTATGAAGAATTTGAGAAGCTAAACACCGAAGTATTAGGGGTCTCTGTCGACAGTGTGGTAAGTCAA
ATTTTTATTTCTCCACCTGAACCAAGAAAGAACATTCTGGTCTCAGCATTTTGAAAAATGGTTTCAAGTATTTGATGTACTCAGAACCTTGGCAAGTGGCAGTCTGATAATCGAATGGAA
CGTTTTCTTTTGGATAATGGAACGTTTGATTCCATGTTCATGTAGTTCTCGCATCTTGCGTGGGTCCAAACAGACAGAAAGTCGGGAGGGCTCGGTGATCTGAATTATCCTCTTGTTTCG
GATATCACTAAATCCATTTCAAAATCGTTTGGAGTGCTCATCCCTGATCAG
GTAAACGATTTCTTCTGACATAGTTGCATCATACTTGCATTGAGTCCAATCCACTTGTGTTCTTTCAAG
TAACGTATAGCCACTTTGAATCAAAGCATTTTGCTAATATATAAGTACAGGGCATTGCACTGAGAGGGCTTTTCATCATAGACAAGGAAGGAGTCATTCAGCATTCCACCATCAACAACC
TCGGTATTGGCCGAAGTGTTGATGAGACAATGAGAACCCTCCAG
GTAATAAAGAGAAAAATCACATCATTGAGATAGATAGATAAAGAGAGATTTGTTTTTGAGGTTTAGGGTTTAGATG
CGTTATTTGTTGCTTCTTGTGATGTTGTCTTGCAGGCATTACAGTATGTTCAAGAAAACCCGGATGAAGTGTGCCCTGCGGGATGGAAGCCAGGGGAGAAATCAATGAAACCTGACCCCA
AGCTCAGCAAAGAATACTTTTCAGCTATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAATGGCGTCTATAGCTTCTTCTTCTTCCACCACCCTACTCTCTTCCTCTAGGGTTCTTCTTCCCTCCAAGTCTTCTCTTTTATCTCCTACCGTCTCTTTCCCCAGAATCATACCC
TCTTCCTCGGCATCATCCTCTTCTCTCTGTTCCGGGTTCTCCAGTCTCGGTTCCCTCACCACCAACCGCTCCGCCTCACGCCGGAACTTCGCCGTCAAGGCTCAGGCT
GATGATTTACCA
CTGGTCGGTAATAAGGCGCCTGATTTTGAAGCTGAGGCAGTTTTTGATCAAGAGTTCATAAAG
GTGAAGCTCTCTGAGTACATTGGCAAAAAGTATGTTATTCTATTCTTCTACCCTTTG
GACTTCACTTTTGTCTGCCCCACTG
AGATTACTGCCTTCAGTGACCGTTATGAAGAATTTGAGAAGCTAAACACCGAAGTATTAGGGGTCTCTGTCGACAGTGTGTTCTCGCATCTTGCG
TGGGTCCAAACAGACAGAAAGTCGGGAGGGCTCGGTGATCTGAATTATCCTCTTGTTTCGGATATCACTAAATCCATTTCAAAATCGTTTGGAGTGCTCATCCCTGATCAG
GGCATTGCA
CTGAGAGGGCTTTTCATCATAGACAAGGAAGGAGTCATTCAGCATTCCACCATCAACAACCTCGGTATTGGCCGAAGTGTTGATGAGACAATGAGAACCCTCCAG
GCATTACAGTATGTT
CAAGAAAACCCGGATGAAGTGTGCCCTGCGGGATGGAAGCCAGGGGAGAAATCAATGAAACCTGACCCCAAGCTCAGCAAAGAATACTTTTCAGCTATCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTTCTTTCT TCTTGTCTGA AAAATCTAGA AGAGCAGCTA TTTGGTTTCT CTATCCGATT CGTCTCTCTC ACGCCCTCAC GTTTATCCAC CTCATCCTCA AACCAAACCA CAAGACCTCT  TTTTTAAGTA ACCAATCACA GAGAGATAGA GAGAGAGAAC AGAGTCAATG TCAATGGCGT CTATAGCTTC TTCTTCTTCC ACCACCCTAC TCTCTTCCTC TAGGGTTCTT CTTCCCTCCA  AGTCTTCTCT TTTATCTCCT ACCGTCTCTT TCCCCAGAAT CATACCCTCT TCCTCGGCAT CATCCTCTTC TCTCTGTTCC GGGTTCTCCA GTCTCGGTTC CCTCACCACC AACCGCTCCG  CCTCACGCCG GAACTTCGCC GTCAAGGCTC AGGCTGATGA TTTACCACTG GTCGGTAATA AGGCGCCTGA TTTTGAAGCT GAGGCAGTTT TTGATCAAGA GTTCATAAAG GTGAAGCTCT  CTGAGTACAT TGGCAAAAAG TATGTTATTC TATTCTTCTA CCCTTTGGAC TTCACTTTTG TCTGCCCCAC TGAGATTACT GCCTTCAGTG ACCGTTATGA AGAATTTGAG AAGCTAAACA  CCGAAGTATT AGGGGTCTCT GTCGACAGTG TGTTCTCGCA TCTTGCGTGG GTCCAAACAG ACAGAAAGTC GGGAGGGCTC GGTGATCTGA ATTATCCTCT TGTTTCGGAT ATCACTAAAT  CCATTTCAAA ATCGTTTGGA GTGCTCATCC CTGATCAGGG CATTGCACTG AGAGGGCTTT TCATCATAGA CAAGGAAGGA GTCATTCAGC ATTCCACCAT CAACAACCTC GGTATTGGCC  GAAGTGTTGA TGAGACAATG AGAACCCTCC AGGCATTACA GTATGTTCAA GAAAACCCGG ATGAAGTGTG CCCTGCGGGA TGGAAGCCAG GGGAGAAATC AATGAAACCT GACCCCAAGC  TCAGCAAAGA ATACTTTTCA GCTATCTAGA GGCTAAGATT GAACACATGT TTGGTGAAAA TTAGCAATCA GAGTTGTTTT ATTCGTCTTT TCAAAGTTGG AGCAGAGTTG TTATTTTTAG  CCAAAGAACC TTTGTATCTA TCTCATCTTT CTCCTGTTTC TGCTATGTGA TTCTCCTTAA ATTGAATCAA AAATAAAGAA ATCCTTCTTT TCTTTTGCCA ATATTTATGT CTTTCACTTG 
TGT 

Retrieve as FASTA