Entry information : At1CysPrx (At1g48130 / ATPER1 / PER1)
Entry ID 4362
Creation 2007-01-19 (Christophe Dunand)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: At1CysPrx (At1g48130 / ATPER1 / PER1)
Name (synonym) At1CysPrx (At1g48130 / ATPER1 / PER1)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Seeds
Siliques
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value At1CysPrx
start..stop
S start..stop
Crub1CysPrx01 441 6e-161 1..216 1..216
Ahal1CysPrx01 434 4e-158 1..216 1..216
Aly1CysPrx 433 2e-157 1..216 1..216
Bstr1CysPrx01 427 4e-155 1..216 1..216
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17780610..17780727 118 N° 2 17780816..17780964 149 N° 3 17781054..17781182 129 N° 4 17781246..17781500 255
join(17780610..17780727,17780816..17780964,17781054..17781182,17781246..17781500 )


exon

Literature and cross-references At1CysPrx (At1g48130 / ATPER1 / PER1)
Literature Haslekas C., Stacy R.A.P., Nygaard V., Culianez-Macia F.A., Aalen R.B. The expression of a peroxiredoxin antioxidant gene, AtPer1, in Arabidopsis thaliana is seed-specific and related to dormancy. Plant Mol. Biol. 36:833-845(1998).
Protein ref. UniProtKB:   O04005   Q42319 [Fragment]   Q84WE3 [Mismatch]
DNA ref. Phytozome 11:   Chr1 (17780610..17781500)
Cluster/Prediction ref. Phytozome Gene 11:   19656713 UniGene:   At.38476
Omic ref. AtProteome:   At1g48130 ATTED-II:   At1g48130 e-FP Browser:   At1g48130 ePlant:   At1g48130 Genevestigator:   At1g48130 TAIR:   At1g48130
Protein sequence: At1CysPrx (At1g48130 / ATPER1 / PER1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   216
PWM (Da):   %s   23979.19  
PI (pH):   %s   6.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGITLGDTVPNLEVETTHDKFKLHDYFANSWTVLFSHPGDFTPVCTTELGAMAKYAHEFDKRGVKLLGLSCDDVQSHKDWIKDIEAFHGSKVNYPIIADPNKEIIPQLNMIDPIENGPSRALHIVGPDSKIKLSFLYPSTTGRNMDEVLRALDSLLMASKHNNKIATPVNWKPDQPVVISPAVSDEEAKKMFPQGFKTADLPSKKGYLRHTEVS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns), 5 cDNA and 20 ESTs. Four TREMBL accessions: O04005, Q84WE3 (1 mismatch), Q42319 (fragment and 3 mismatches) and Q42320 (fragment and 1 mismatch).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCATAATTGA AATTGAACTT GTAAAAACAA ACTGAACCAA TATGACAAAT ATCAATTACC TACAGCCTAA TGGATCTGGT AAAGGACCAT CTATGCCATC CATATAAGAA GCACCAACAT  CTTTAAGTCT TCCTGGACGA CCAACATGCA GTCGTTCCCA TGCCCATAAC TGCAGCAGAA CAAGAGGGCC ACATATGGTA GAAACAGTCC TCTTACTTGC CCGGCACAAC TCTCTGTAGA  GAAGTGCTAG AGTAGCACTA CCCCAGCTAA GCTTAGCCAC TTCATCAAAG TCCCTTAGCA GAGGGAGAAA CGTCAAAGCC ACATCATGTT TAGACTTATC TCCATAAAGA AAACCACTCA  TCAAAGCTAA TACAAAAGCT CTAGTGTGAC ACTTCAACGT CACTTCATCA GGATCAGCAG GTAAATTCCG AAAATTCTCA CGCAGCCACG CTAAGGACAC ATGAGAACCA TGAAGATCCT  TGGGACCTGG CCTATGACCA AGCAAATCCT CACATAAATC AGCCCAGTTG TATTTTGTAC TACCAGTTAC TGCAGGTCCA TCGACACGTA GACCCAACAA AATATTCACA TCTTGTAAAG  TCACAGTGAT CTCTCCAGCA GGAAGATGAA AAGTATGCGT TTCGGGTCTC CATCTCTCCA CCAAAGCTGT TATCAGAGCA TAATCAAGTT GTATAAAGGC AACCTTGTAA ACTCCATATA  GACCAAACTC TATCAACTTT TGACACACGA GAGGATCCAG AGGCCAATCT CGCATCCCCA ATAACTTGTG CCGACATGTC AGTTCACGAG GAGGAACCTG AATGTGAAGT ATAACGGTAA  AAAGGAAATA ATTAAAACAA CGGAAGCAAA ACAAGAAACA AGATGAAATG AGAAACTAGT AACACACCTC ATCTTCCCAT ATAGCAGCTG ATCTATGCTC ATGTTGCCAC ACCAATATAG  ATTGATCAAC TGGACCAGGA TCCAAATCAA AGTTTAATAG ACTTTGCACC TCCATCTATA TAATATATCA CAGGACAATA AACACAATGA TCAGTGATTA TACAACATCA AAGAAAACTT  GTAATTCTGG GAATATAACT GAGAAATGAG AATTAAAGAT TCATAATTTG AACACAAGAA ATCCTAAACT GGTACGAAAG AAAAATTGCT CAACAAAAAA ATCAAGCTAA TTACTCGTAT  ACAAAGACAC GAAGAACTAA TACAAGAAAC AAGAAACAAC AAACCACAAA GAGATTGAAC CAATCCAAAT TCGACAACAT AAACCAAGTG TGTGGGTGAT TGGAATCAGA GGACGTACCA  AAGAAAAGCG TCCGTGATCA ACAAAAACCA AAAAGAGACG TTTGAAATAA ACCAGAGGAA GACGAAGAAT AATTAAGCAA AGAGAAGCGT TAAGCGGGAG CGAGAAAGGA AACGAGAGAA  AGAGAGAGCT TCCAGATCCG ACAGAAGTTT TCGGCTTCTT CTTTTTCGTT TAAGAACTTC TGATCCTCCT AGGTCTGTCC GAAGAACTAA TCTTTTTGAG GTAACGACGC CGTTTTTCTC  AAAACATGGG CCCATTAACC ATAGTCTCGG CCCAAACGAA ACTTAATACG ACAATGTTTG GGTGTAAACG CAAAGATTTT GTCGATTATC ACAAGTAAAA AAATAAATAC AAACACTTGA  GTCTCTCTAG ACATCGTGCG TCGCCTTAGC TTTAAGTTTT TTCTCGAAAC AAAAGAGTTA TTTTATTTGA ACTTTGAAGA TTATACGAAG ACACGTGGCG TGAACCCAAT TCATAACAAC  GCCACGCTAT ACTCTTTTGC ATGCACCTCA ATTTGAACAT CATCAAGTCT CTCTCTCTCT TTTTCTGACT TTGATCCACG AACCTAACCA GCTTGCGATC TCTATTTAAT CGGTCCTCGA 
CGCAACTTCA ACTTCTACTA CATCCATTCA CATCAAATCA ATACAGAAAG TTTTTTCTAT ATATAAATAT AAAAGGTAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGATAATAA CAAAAGCCTA CTATATAACG TACATGCAAG TATTGTATGA TATTAATGTT TTTACGTACG TGTAAACAAA AATAATTACG TTTGTAACGT ATGGTGATGA TGTGGTGCAC  TAGGTGTAGG CCTTGTATTA ATAAAAAGAA GTTTGTTCTA TATAGAGTGG TTTAGTACGA CGATTTATTT ACTAGTCGGA TTGGAATAGA GAACCGAATT CTTCAATCCT TGCTTTTGAT  CAAGAATTGA AACCGAATCA AATGTAAAAG TTGATATATT TGAAAAACGT ATTGAGCTTA TGAAAATGCT AATACTCTCA TCTGTATGGA AAAGTGACTT TAAAACCGAA CTTAAAAGTG  ACAAAAGGGG AATATCGCAT CAAACCGAAT GAAACCGATA TGAAACCGCA TCAAACCGAT ATAGCGTGAA CCAAAATGTG GATTAATGAC ATTTAGACCG GAGGAACATA AGTGGGGACT  ATACGGCATC GTTTTAGTGT ATAAGTGAAT TCGCATATTC ACGAGTTCCC CGTATTCACC GGTTGTTATA TCGTCGATTC ATCGTCGTCG ACGGCGAGTA CTTGTGACCT CCACACCCAG  ATTAATCTTC TATAACTGAT TTTATCGCTT AGACGATCAC GATCTCATCG ATTAACTGTG AGTATAATCG ATTCCTCCTC TTTATTTTGT GTGTTGTATC GATTTACGAT AATTTTTTGG  AGGAACATCT CCTTTCGGAT CGGTTTTGTT GGGAATTTAT ATTTCTTTGC CATGGTTTTA TCTTGATTTG GTGATTTACC TTGTGTTTGT TCTGGTGTAC TATTTAGCTA ATTTAGTATA  AGCTTTCAGA TGATTCTAGG AAACTTTTGT GCTACTGTTT TCGGTTTTTG GTGATAGAAC TATGTAGTTT TAAGGAACCA TATAAAAATT TCGTCTAGAA ATGTTTCTAT GGTTACTGAT 
CAGTCATCAG TGGTAGCGAT ATGAAATTGG AATCCTGTTT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGGATCACACTAGGAGACACGGTGCCGAACCTAGAAGTGGAGACGACACATGACAAGTTCAAACTTCATGACTACTTCGCCAATTCTTGGACCGTCCTCTTCTCTCATCCCGGT
ATATATGTTAATATATAGATCTTGAGTTCTTGACTTCTGTTGCAATTCCTTTTTTGTTTTCTTGATTTTTGTTGACGGTCACACAGGGGATTTCACACCCGTGTGCACCACGGAGCTTGG
TGCGATGGCCAAATACGCTCATGAGTTCGATAAGAGAGGCGTGAAGCTCCTTGGTCTGTCTTGTGACGATGTACAGTCACACAAAGACTGGATCAAAGATATTGAAGCCTTTAAT
GTATA
ATTTAAATCTCATGCATGCATATACCAGACTAGCTAGAGATCATATTTTGGTTTTGATTAATTTGTTACATATGTATGATATAGCACGGAAGCAAGGTGAATTACCCGATAATCGCTGAC
CCGAACAAAGAGATCATTCCTCAGCTTAACATGATTGATCCAATTGAGAACGGACCGTCTCGTGCCCTTCATATTGTTGGTCCTGACAGTAAG
GTAATAATTTCATATATTATTGCATGT
ATGATTTTATTGGTTAATTGGATTTGTGATATATAGATAAAATTGAGCTTCTTGTATCCGTCGACCACGGGACGTAACATGGACGAAGTATTGAGGGCTTTAGACTCGTTGTTGATGGCG
TCCAAGCACAATAACAAGATCGCCACTCCGGTTAACTGGAAGCCAGATCAACCGGTTGTGATTTCGCCTGCTGTGTCGGACGAGGAAGCCAAAAAGATGTTCCCACAGGGTTTCAAGACC
GCCGATCTTCCGTCAAAGAAAGGCTATCTGCGTCACACAGAGGTCTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGGATCACACTAGGAGACACGGTGCCGAACCTAGAAGTGGAGACGACACATGACAAGTTCAAACTTCATGACTACTTCGCCAATTCTTGGACCGTCCTCTTCTCTCATCCCGGG
GATTTCACACCCGTGTGCACCACGGAGCTTGGTGCGATGGCCAAATACGCTCATGAGTTCGATAAGAGAGGCGTGAAGCTCCTTGGTCTGTCTTGTGACGATGTACAGTCACACAAAGAC
TGGATCAAAGATATTGAAGCCTTTAAT
CACGGAAGCAAGGTGAATTACCCGATAATCGCTGACCCGAACAAAGAGATCATTCCTCAGCTTAACATGATTGATCCAATTGAGAACGGACCG
TCTCGTGCCCTTCATATTGTTGGTCCTGACAGTAAG
ATAAAATTGAGCTTCTTGTATCCGTCGACCACGGGACGTAACATGGACGAAGTATTGAGGGCTTTAGACTCGTTGTTGATGGCG
TCCAAGCACAATAACAAGATCGCCACTCCGGTTAACTGGAAGCCAGATCAACCGGTTGTGATTTCGCCTGCTGTGTCGGACGAGGAAGCCAAAAAGATGTTCCCACAGGGTTTCAAGACC
GCCGATCTTCCGTCAAAGAAAGGCTATCTGCGTCACACAGAGGTCTCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGCGATCTC TATTTAATCG GTCCTCGACG CAACTTCAAC TTCTACTACA TCCATTCACA TCAAATCAAT ACAGAAAGTT TTTTCTATAT ATAAATATAA AAGGTAAAAT GCCAGGGATC  ACACTAGGAG ACACGGTGCC GAACCTAGAA GTGGAGACGA CACATGACAA GTTCAAACTT CATGACTACT TCGCCAATTC TTGGACCGTC CTCTTCTCTC ATCCCGGGGA TTTCACACCC  GTGTGCACCA CGGAGCTTGG TGCGATGGCC AAATACGCTC ATGAGTTCGA TAAGAGAGGC GTGAAGCTCC TTGGTCTGTC TTGTGACGAT GTACAGTCAC ACAAAGACTG GATCAAAGAT  ATTGAAGCCT TTAATCACGG AAGCAAGGTG AATTACCCGA TAATCGCTGA CCCGAACAAA GAGATCATTC CTCAGCTTAA CATGATTGAT CCAATTGAGA ACGGACCGTC TCGTGCCCTT  CATATTGTTG GTCCTGACAG TAAGATAAAA TTGAGCTTCT TGTATCCGTC GACCACGGGA CGTAACATGG ACGAAGTATT GAGGGCTTTA GACTCGTTGT TGATGGCGTC CAAGCACAAT  AACAAGATCG CCACTCCGGT TAACTGGAAG CCAGATCAAC CGGTTGTGAT TTCGCCTGCT GTGTCGGACG AGGAAGCCAA AAAGATGTTC CCACAGGGTT TCAAGACCGC CGATCTTCCG  TCAAAGAAAG GCTATCTGCG TCACACAGAG GTCTCTTGAA AAGATAATAA CAAAAGCCTA CTATATAACG TACATGCAAG TATTGTATGA TATTAATGTT TTTACGTACG TGTAAACAAA  AATAATTACG TTTGTAACGT ATGGTGATGA TGTGGTGCAC TAGGTGTAGG CCTTGTATTA ATAAAAAGAA GTTTGTTCTA TATAGAGTGG TTTAGTACGA CGATTTATTT ACTAGTCGGA 
TTGGAATAGA GAACCGAATT CTTCAA 

Retrieve as FASTA