Entry information : Pv2CysPrx01-1 ( Phvul.001G194200.1 )
Entry ID 4405
Creation 2007-02-01 (Nicolas Rouhier)
Last sequence changes 2016-02-05 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-05 (Achraf Jemmat)
Peroxidase information: Pv2CysPrx01-1 ( Phvul.001G194200.1 )
Name (synonym) Pv2CysPrx01-1 ( Phvul.001G194200.1 )
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Phaseolus
Organism Phaseolus vulgaris    [TaxId: 3885 ]
Cellular localisation Chloroplastic
Tissue types Leaves
Mixed tissues
Pods
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pv2CysPrx01-1
start..stop
S start..stop
Pv2CysPrx01-2 523 0 1..260 1..260
Pau2CysPrx01 452 2e-163 1..260 1..261
Ps2CysPrx 438 5e-158 1..260 1..263
Mt2CysPrx02 422 7e-152 14..260 15..265
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..189 189 N° 2 800..874 75 N° 3 957..1038 82 N° 4 1114..1193 80
N° 5 1885..2010 126 N° 6 2209..2322 114 N° 7 2467..2583 117  
join(1..189,800..874,957..1038,1114..1193,1885..2010,2209..2322,2467..2583)


exon

Literature and cross-references Pv2CysPrx01-1 ( Phvul.001G194200.1 )
Literature Genot G et al., Molecular characterisation of a bean chloroplastic 2-Cys peroxiredoxin. Plant Physiol. Biochem. 39:449-459(2001).
Protein ref. UniProtKB:   Q9FE12
DNA ref. GenBank:   AJ288896.1 (474..3056)
EST ref. GenBank:   FE687891.1
Protein sequence: Pv2CysPrx01-1 ( Phvul.001G194200.1 )
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   261
PWM (Da):   %s   28604.63  
PI (pH):   %s   4.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSAPCASLISSNPNILFSPKFPSSSFSSLSFPNSPNSLFKPLRTSLNPSSPPLRTFVARASSELPLVGNTAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYAEFEALNTEILGVSVDSFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSYDVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETKRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST. cultivar="Negro Jamapa 81" and "G19833".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCAGCTCCCTGTGCTTCTCTCATATCCTCAAACCCTAACATTCTCTTCTCTCCCAAATTCCCTTCTTCTTCCTTTTCTTCCCTCTCCTTCCCCAATTCCCCCAACTCTCTT
TTCAAACCTTTACGCACTTCTCTCAATCCTTCATCTCCCCCTCTCAGAACCTTCGTTGCCAGGGCTTCG
GTAATTCTTTTCTCCTACCACTTACTCTCCTTTTCCCACTTAAATCTTACA
TTGCGCTGCAACAATTTGCTCCTTTTTTATGTTTCTGCTGATTTTACTGTTACCTGCTTCTTTGCTTGCTTGCTTGTTGGCCTCTATTTTTTGTGCATTTTTCTCTCTTCCCATCAATGT
GTGCTTTCATATCCAACTCTCTTGTTTCTAGTCCTCGCTGCTCTCGCTCACCTGCTAATTTTATGCACTTCTGTGACTGAACTGTGGAAATGAACTACGGCGGTGATTGTGAAAATTCTG
TTTCTGTTTGCTGCATTTCTGAGCATATTACTTCAAGATGTGTTGCATGTCATCCAGTGTAGCACAGATTCATTGTAATTTGTAATTAGTCGAACAATGCTTTAAAATAATATGGTAATT
CTACATTCTTCCTTCTTCAAGGTTGTAAGTTTTGTATTGGAATTTCTATTCGTGTGTGGGAGAATCTACTTCTGCAAAGCTTTACAGCTGTAACTTCCTTGATGAAGCTGAAAACTCAAT
TTTTTTTATAGTGTACTATTTCTCTGGCCTGACCTTTGAAGCAATTTATTTATTCTTTTTTGTTTGCTTATTTTGAAAGAGTGAACTTCCATTAGTTGGGAACACAGCACCGGATTTTGA
AGCAGAGGCCGTTTTTGATCAGGAGTTCATCAAG
GTATTTACGATGGAATGCTGATTGGTAAATTTTGTGATTACAAATTATGTTGAATGAAACACTGTCTTGTCTTGTCTGTCAGGTCA
AACTATCTGATTATATTGGGAAAAAATATGTTATCCTCTTTTTCTATCCACTGGACTTCACATTCGTTTGTCCGACAG
GTTAGTAGACTTCTGATTGCGATTGCTGTGGATCCTAAATTT
TCTCCTTTTTAACTGTTCATTACTTGTGTACAGAAATCACTGCCTTCAGTGACCGGTATGCAGAGTTTGAGGCACTAAATACAGAAATTTTGGGTGTTTCAGTTGACAGTGTTGTGAGTT
GTTTTGATCCCTTTTTTAATTATTTCTTCAGATTCTAGCTCTTGTATAATTTTCCCCCCATACTTTTATTCTATGGCATTGTTTGATCCATATAACTGACAATACCAATTGAGGAAAAAG
GCTTTGTTTGCTGTAATACTTTTATCGATTCTTGAAAAGACATGTTTTTTGCCTGTATACAAGCTGCTGAGAACATGAAAGGTGTTCGATGACTTTGCCCTCTAACTGCTTAGGTTAAGG
TTTTAATGATTCATTTGAGAGGAAGAAGCTATGACCGAGAGTTCTGAGCATAATTGGCAAAACTGTATGAATTCTGCATTTTTTTCTCTTTCAAACTTAATGCAAAGAATTAGGATGTAT
CGGACAGTATGGTCAGTGGAAATTACTATATAAATAATGGAAAGCCAAATATTGGACAATGAGTTCATTCCAACCTTAATAATTGAAATGTCTTTTTCTTGACCCACAGATGTAATGTTA
TTCTCAATATTTGTGAAGGATGTGTGACATTGTGGAGTGGGACGCAGTATTCCCACTTGTTCCCAAGAAAACAGACAGATTTTTATGTTATGATCTATTACCGTTCCTATTTCTAAATGC
ACAATTAACTTTTTATAGCCTTATCCGTAGGCCCTTCTTAAGTTTGCTTCTTCTTGATCAGTGGTGCTGTTGTTATCATTGTAGTTTTCACACCTTGCATGGGTTCAAACTGATAGAAAG
TCGGGTGGTCTTGGCGACTTGAATTATCCATTGATTTCTGATGTCACCAAATCCATCTCAAAATCTTATGATGTTCTCATTCCCGATCAG
GTATTTTTTTATAATGATATATTCATATTC
CCCTGCTATCATCAGCCCCAATGTATTTTGTGCTTTAGTTTCAAATTCTCTGGAAAGAAATGTAGGATGCTGTCTAGGTTCATTGTTTAAATATTGTTTGTGAAACTATTGATTTTCATT
AACTTTTTTAGCACCTTTCACAACAATTCTAAATGTTTCCAATGATTGGGGATTGCATTGAGAGGATTGTTCATTATTGACAAGGAAGGGGTTATTCAGCATTCTACCATTAACAACCTG
GCCATTGGTAGAAGTGTTGATGAGACAAAGAGAACGCTCCAG
GTAATTATACGAAAAATCAGGACAACACCAGGATTGACAATTTTTTTAGTATATGTTGAACTCTTTTTTTTTTTCTTT
TTTTTTTTCTAGTCATCTGTCATTTATATAAATTCTTGGCATCCATTTATGTGCATTGGTTTCCAGGCCTTGCAGTATGTGCAGGAGAACCCAGATGAAGTTTGCCCAGCTGGGTGGAAG
CCTGGTGAGAAGTCCATGAAACCAGACCCTAAACTTAGCAAAGAGTACTTCTCTGCTATTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCAGCTCCCTGTGCTTCTCTCATATCCTCAAACCCTAACATTCTCTTCTCTCCCAAATTCCCTTCTTCTTCCTTTTCTTCCCTCTCCTTCCCCAATTCCCCCAACTCTCTT
TTCAAACCTTTACGCACTTCTCTCAATCCTTCATCTCCCCCTCTCAGAACCTTCGTTGCCAGGGCTTCG
AGTGAACTTCCATTAGTTGGGAACACAGCACCGGATTTTGAAGCAGAGGCC
GTTTTTGATCAGGAGTTCATCAAG
GTCAAACTATCTGATTATATTGGGAAAAAATATGTTATCCTCTTTTTCTATCCACTGGACTTCACATTCGTTTGTCCGACAGAAATCACTGCCTTC
AGTGACCGGTATGCAGAGTTTGAGGCACTAAATACAGAAATTTTGGGTGTTTCAGTTGACAGTGTT
TTTTCACACCTTGCATGGGTTCAAACTGATAGAAAGTCGGGTGGTCTTGGCGAC
TTGAATTATCCATTGATTTCTGATGTCACCAAATCCATCTCAAAATCTTATGATGTTCTCATTCCCGATCAG
GGGATTGCATTGAGAGGATTGTTCATTATTGACAAGGAAGGGGTTATT
CAGCATTCTACCATTAACAACCTGGCCATTGGTAGAAGTGTTGATGAGACAAAGAGAACGCTCCAG
GCCTTGCAGTATGTGCAGGAGAACCCAGATGAAGTTTGCCCAGCTGGGTGGAAG
CCTGGTGAGAAGTCCATGAAACCAGACCCTAAACTTAGCAAAGAGTACTTCTCTGCTATTTAG

Retrieve as FASTA