Entry information : Pno2CysPrx
Entry ID 4478
Creation 2007-01-30 (Nicolas Rouhier)
Last sequence changes 2012-05-22 (Nicolas Rouhier)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: Pno2CysPrx
Name Pno2CysPrx
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Phaeosphaeriaceae Phaeosphaeria
Organism Phaeosphaeria nodorum (Stagonospora nodorum)    [TaxId: 13684 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pno2CysPrx
start..stop
S start..stop
Tmel2CysPrx 303 3e-106 10..205 3..196
Cal2CysPrx01 293 3e-102 12..204 5..195
Dh2CysPrx 286 7e-100 10..204 3..195
Yl2CysPrx 277 5e-96 10..204 3..195
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 784768..784858 91 N° 2 784935..785515 581  
join(784768..784858,784935..785515)


exon

Literature and cross-references Pno2CysPrx
Literature The Broad Institute Genome Sequencing Platform. Annotation of the Phaeosphaeria nodorum SN15 genome.
Protein ref. GenPept:   111070709 UniProtKB:   Q0V6N0
DNA ref. JGI genome:   scaffold_1 (784768..785515)
Protein sequence: Pno2CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   223
PWM (Da):   %s   24285.37  
PI (pH):   %s   4.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFPAYTPKARVQKPAPNFSTTAVVDGTFEELSLTAYTSTKQWLVLGFVPMAWTFVCPTEIIAFSERIADFTARNASVVFASTDSEYSLLAWTMASRKDGGLGKIDIPLISDKNHSISKDYGVLIEEEGIALRGLFLIDPNGIVRQITINDLPVGRSVDETLRLIDAFQFTDKYGEVCPANWNPGDETIKATPEGNKEYLGKVHADTKMSDVAKTNGKSIPAR

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 exons). Strain="SN15".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTCCGGCATACACCCCCAAGGCGCGCGTGCAGAAACCTGCACCGAACTTTTCTACTACAGCAGTTGTTGATGGCACATTCGAAGGTAAGCTTCCACTATTTCACATTCCAGCG
ACCCAAATGCAGCCATCATGTAGACCACAACTGACAATTAATCTCAGAACTCTCCCTAACAGCCTACACCTCCACGAAGCAATGGCTCGTCCTCGGCTTCGTCCCTATGGCCTGGACCTT
CGTCTGCCCCACCGAAATCATCGCCTTCAGCGAACGCATCGCCGACTTCACTGCTCGCAACGCTAGCGTTGTCTTCGCATCTACAGATTCCGAGTACAGCCTACTCGCCTGGACCATGGC
GAGTCGGAAAGACGGTGGATTGGGCAAAATCGACATTCCCTTGATCTCCGACAAGAACCACAGTATTAGCAAGGACTACGGAGTGCTGATCGAGGAGGAGGGCATCGCGCTCAGAGGACT
GTTCTTGATCGACCCCAATGGTATTGTAAGGCAGATTACCATCAACGATCTCCCTGTTGGCCGCAGTGTGGATGAGACTCTCCGTCTGATCGACGCCTTCCAGTTCACAGACAAATACGG
CGAGGTGTGCCCTGCAAACTGGAACCCTGGTGATGAGACCATCAAGGCTACGCCAGAGGGCAACAAGGAGTACTTGGGCAAGGTGCATGCGGACACTAAGATGTCTGATGTTGCGAAGAC
GAACGGTAAGTCCATACCGGCGAGATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTCCGGCATACACCCCCAAGGCGCGCGTGCAGAAACCTGCACCGAACTTTTCTACTACAGCAGTTGTTGATGGCACATTCGAAGAACTCTCCCTAACAGCCTACACCTCCACG
AAGCAATGGCTCGTCCTCGGCTTCGTCCCTATGGCCTGGACCTTCGTCTGCCCCACCGAAATCATCGCCTTCAGCGAACGCATCGCCGACTTCACTGCTCGCAACGCTAGCGTTGTCTTC
GCATCTACAGATTCCGAGTACAGCCTACTCGCCTGGACCATGGCGAGTCGGAAAGACGGTGGATTGGGCAAAATCGACATTCCCTTGATCTCCGACAAGAACCACAGTATTAGCAAGGAC
TACGGAGTGCTGATCGAGGAGGAGGGCATCGCGCTCAGAGGACTGTTCTTGATCGACCCCAATGGTATTGTAAGGCAGATTACCATCAACGATCTCCCTGTTGGCCGCAGTGTGGATGAG
ACTCTCCGTCTGATCGACGCCTTCCAGTTCACAGACAAATACGGCGAGGTGTGCCCTGCAAACTGGAACCCTGGTGATGAGACCATCAAGGCTACGCCAGAGGGCAACAAGGAGTACTTG
GGCAAGGTGCATGCGGACACTAAGATGTCTGATGTTGCGAAGACGAACGGTAAGTCCATACCGGCGAGATAG

Retrieve as FASTA