Entry information : Pc2CysPrx01-2 (Pc2CysPrx01-b)
Entry ID 4506
Creation 2007-01-30 (Nicolas Rouhier)
Last sequence changes 2007-01-30 (Nicolas Rouhier)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-09 (Christophe Dunand)
Peroxidase information: Pc2CysPrx01-2 (Pc2CysPrx01-b)
Name (synonym) Pc2CysPrx01-2 (Pc2CysPrx01-b)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pc2CysPrx01-2
start..stop
S start..stop
Pc2CysPrx01-1 409 3e-148 1..199 1..199
Pcar2CysPrx01-1 392 1e-141 1..199 1..199
Ccin2CysPrx 341 2e-121 1..196 1..196
Ppl2CysPrx01-1B 337 4e-120 1..194 1..194
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 115050..115150 101 N° 2 114979..115002 24 N° 3 114842..114927 86 N° 4 114515..114792 278
N° 5 114356..114461 106 N° 6 114249..114256 8  
complement(join(114249..114256,114356..114461,114515..114792,114842..114927,1149 79..115002,115050..115150))


exon

Literature and cross-references Pc2CysPrx01-2 (Pc2CysPrx01-b)
Literature Quan J., Yi Z.Z. Phanerochaete chrysosporium peroxiredoxins (Prxs) mRNA.
Protein ref. UniProtKB:   Q5MJG6
DNA ref. JGI genome:   scaffold_19 (115150..114249)
mRNA ref. GenBank:   DV764538.1
Protein sequence: Pc2CysPrx01-2 (Pc2CysPrx01-b)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   200
PWM (Da):   %s   22018.29  
PI (pH):   %s   4.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAQVQKPAPTFKAQAVVDGVFQDVSLSDYLGQWVVLFFYPMDFTFVCPTEILAFNDSLEAFKELNTVVGVSTDSAYSHFAWASQPRNQGGLGPNLKLPLIADRNMKISRDYGVLLEEDGVALRGLFIIDPKGVLRQITVNDLPVGRSVDETIRLIKAFQFEKYGEVCPANWKEGGKTMKADPKGSLEYFSTVNTNAQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns), cDNA and 4 ESTs (DV758150, DV755748, DV759024, DV755438). Strain="RP-78". Alternative splicing with an extra intron (and very short last exon)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGCTCAGGTCCAGAAGCCCGCCCCCACCTTCAAGGCTCAGGCCGTTGTCGACGGTGTCTTCCAGGATGTCTCTCTTTCCGACTACCTCGGCCAATGGTATGTTGCACTACATTGC
AAACGTACGGCTCGCTAATATCGCACAGGGTCGTCCTCTTCTTCTACCCCATGTGAGTTGCAAACGACGCGTCAAATCTGACATGCCACTAACATGTCATCAGGGACTTCACCTTTGTCT
GCCCCACCGAGATTCTCGCCTTCAACGACTCTCTTGAGGCGTTCAAGGAGTTGAACACTGTCGTTCTCG
GTATGTGCATTTGAATGTCTTTCGCGGAGCGCATTCTGATACGTTGCAGGT
GTTTCCACCGACTCTGCCTACTCCCACTTCGCCTGGGCGTCCCAGCCCCGCAACCAGGGCGGTCTCGGCCCCAACCTCAAGCTCCCGCTCATCGCCGACCGCAACATGAAGATCTCCCGC
GACTACGGCGTTCTCCTCGAGGAGGACGGTGTTGCTCTTCGCGGCCTCTTCATCATCGACCCTAAGGGCGTCCTCCGCCAGATCACCGTCAACGATCTCCCTGTCGGCCGCTCCGTCGAC
GAGACCATCCGCCTCATCAAGGCGTTCCAGTTCGTC
GTACGTGTTCATGTTCTTGCTCAGCGTTGCACGTGTCACTCACTTCCTTGCAGGAGAAGTACGGCGAAGTCTGCCCCGCCAACT
GGAAGGAGGGTGGCAAGACCATGAAGGCCGACCCGAAGGGTTCCCTCGAGTACTTCTCCACTGTCAACACCAATG
GTACGGACGACGGTGCGAGGAAGCGCCCCCGCCTCGAATGAGTTT
CTCGAACCGAGATGCTGACCTTTTTGTCCTCCCCTTTTGCTCTGGACTACACAGCCCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGCTCAGGTCCAGAAGCCCGCCCCCACCTTCAAGGCTCAGGCCGTTGTCGACGGTGTCTTCCAGGATGTCTCTCTTTCCGACTACCTCGGCCAATGGGTCGTCCTCTTCTTCTAC
CCCAT
GGACTTCACCTTTGTCTGCCCCACCGAGATTCTCGCCTTCAACGACTCTCTTGAGGCGTTCAAGGAGTTGAACACTGTCGTTCTCGGTGTTTCCACCGACTCTGCCTACTCCCAC
TTCGCCTGGGCGTCCCAGCCCCGCAACCAGGGCGGTCTCGGCCCCAACCTCAAGCTCCCGCTCATCGCCGACCGCAACATGAAGATCTCCCGCGACTACGGCGTTCTCCTCGAGGAGGAC
GGTGTTGCTCTTCGCGGCCTCTTCATCATCGACCCTAAGGGCGTCCTCCGCCAGATCACCGTCAACGATCTCCCTGTCGGCCGCTCCGTCGACGAGACCATCCGCCTCATCAAGGCGTTC
CAGTTCGTC
GAGAAGTACGGCGAAGTCTGCCCCGCCAACTGGAAGGAGGGTGGCAAGACCATGAAGGCCGACCCGAAGGGTTCCCTCGAGTACTTCTCCACTGTCAACACCAATGCCCAG
TAG

Retrieve as FASTA