Entry information : GzCMDn01
Entry ID 4646
Creation 2007-02-14 (Filippo Passardi)
Last sequence changes 2007-02-14 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: GzCMDn01
Name GzCMDn01
Class Carboxymuconolactone decarboxylase (no peroxidase activity)    [Orthogroup: CMDn001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GzCMDn01
start..stop
S start..stop
GzCMDn02 268 5e-93 1..187 1..184
CgCMDn 248 8e-85 1..178 1..179
NcCMDn 241 3e-82 1..187 1..192
AfumCMDn02 212 5e-71 1..183 1..184
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5866196..5866684 489 N° 2 5866735..5866780 46 N° 3 5866842..5866888 47  
join(5866196..5866684,5866735..5866780,5866842..5866888)


exon

Literature and cross-references GzCMDn01
Literature Birren B. et al.

Direct Submission

Submitted (02-MAY-2003)
Protein ref. GenPept:   EAA69160 UniProtKB_Uniparc:   Q4ILW2
DNA ref. JGI genome:   Supercontig_3.1 (5866196..5866888)
Protein sequence: GzCMDn01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   193
PWM (Da):   %s   21312.76  
PI (pH):   %s   4.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVPYVSNPPPTNSPEEESIVAAIEARRHPRPLQPLDLALLHSPPIASGWNTFVGAIRTQTSLSDDLRELAICRIAVVNKAWYEWMHHAPLAVKGGVSSNAMKELMTDERLVLENIPDGFTEKQWAICVVADEMTKNVHVADETFQQLKSFFNSQEVVEIVATVACYNCVSRFLVALDVGERNSTTPALPETV

Retrieve as FASTA  
Remarks Complete sequence from Genomic DNA (3 exons, Chromo 1). Strain="PH-1 / NRRL 31084".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGTCCCCTACGTATCAAACCCTCCTCCAACTAATTCTCCAGAAGAGGAGTCAATCGTGGCTGCGATTGAAGCGCGACGACACCCCCGTCCCCTGCAACCCCTTGACCTGGCACTT
CTCCATTCCCCGCCAATTGCTTCTGGCTGGAACACTTTTGTTGGGGCAATTCGGACACAAACGTCACTCTCTGATGACTTGCGAGAACTCGCCATTTGCCGAATTGCCGTTGTCAATAAA
GCGTGGTATGAATGGATGCACCATGCACCCTTGGCAGTCAAGGGAGGTGTGTCTTCGAACGCGATGAAGGAGCTCATGACGGACGAGAGACTTGTTCTTGAAAATATCCCAGACGGCTTT
ACAGAGAAACAATGGGCTATCTGTGTCGTGGCCGATGAAATGACAAAGAATGTCCATGTCGCGGATGAGACATTCCAGCAACTCAAATCTTTTTTCAACAGTCAAGAGGTAGTTGAAATC
GTTGCAACG
GTATGTTGAACTGCATATGCATTGTATTCAAGATTCTTATACTGCTATAGGTTGCGTGTTATAATTGCGTCAGCCGTTTTCTCGTGGCTTTGGATGGTAAGTTTCCCTTGA
ACTTTGCAGCTGTTTTGGAGTCGTGTCTGATGACGTCATTCTGCAGTTGGAGAAAGAAACAGTACCACTCCTGCGCTACCCGAGACCGTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGTCCCCTACGTATCAAACCCTCCTCCAACTAATTCTCCAGAAGAGGAGTCAATCGTGGCTGCGATTGAAGCGCGACGACACCCCCGTCCCCTGCAACCCCTTGACCTGGCACTT
CTCCATTCCCCGCCAATTGCTTCTGGCTGGAACACTTTTGTTGGGGCAATTCGGACACAAACGTCACTCTCTGATGACTTGCGAGAACTCGCCATTTGCCGAATTGCCGTTGTCAATAAA
GCGTGGTATGAATGGATGCACCATGCACCCTTGGCAGTCAAGGGAGGTGTGTCTTCGAACGCGATGAAGGAGCTCATGACGGACGAGAGACTTGTTCTTGAAAATATCCCAGACGGCTTT
ACAGAGAAACAATGGGCTATCTGTGTCGTGGCCGATGAAATGACAAAGAATGTCCATGTCGCGGATGAGACATTCCAGCAACTCAAATCTTTTTTCAACAGTCAAGAGGTAGTTGAAATC
GTTGCAACG
GTTGCGTGTTATAATTGCGTCAGCCGTTTTCTCGTGGCTTTGGATGTTGGAGAAAGAAACAGTACCACTCCTGCGCTACCCGAGACCGTGTAG

Retrieve as FASTA