Entry information : NcCMDn
Entry ID 4649
Creation 2007-02-14 (Filippo Passardi)
Last sequence changes 2007-02-14 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-25 (Catherine Mathe (Scipio))
Peroxidase information: NcCMDn
Name NcCMDn
Class Carboxymuconolactone decarboxylase (no peroxidase activity)    [Orthogroup: CMDn001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora crassa    [TaxId: 5141 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NcCMDn
start..stop
S start..stop
GzCMDn02 261 2e-90 1..193 1..185
CgCMDn 251 5e-86 1..183 1..179
GzCMDn01 241 3e-82 1..192 1..187
AfumCMDn01 202 3e-66 1..189 42..232
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1571578..1572081 504 N° 2 1572285..1572330 46 N° 3 1572384..1572427 44  
join(1571578..1572081,1572285..1572330,1572384..1572427)


exon

Literature and cross-references NcCMDn
Literature Schulte,U., et al.

German Neurospora genome,project.

Direct Submission

Submitted (11-MAR-2003)
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=BX294012&itemID=32&view=gbwithparts
Protein ref. UniProtKB:   Q872E4
DNA ref. JGI genome:   supercont10.5 (1571578..1572427)
Cluster/Prediction ref. UniGene:   Ncr.8616
Protein sequence: NcCMDn
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197
PWM (Da):   %s   21704.06  
PI (pH):   %s   4.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLPYIPNPPPTSSDAEQAIVDRITARRAPRPLQPLDLTLLHSPPVADGWNSFLGAIRTQTLLPADERELAISRVAVCNGAWYEWHHHAPLAVQAGVSEGEDGLGVVKRQEPLLIEEGDQKKGGLNERQWAAVCLTDEMTRNVKVRDETFERVRELFSEREVVELTAIIACYNCVSRFLVALDVGERNGTGPDDAAH

Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 exons, Chromo 2) and 2 ESTs (Unigene and AW712341). Strain="=ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987" and "30-7 (bd; A)".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCTCCCCTACATCCCCAACCCCCCACCCACCTCTTCGGACGCCGAACAAGCCATCGTCGACCGCATCACCGCCCGCCGCGCCCCCCGTCCCCTCCAACCCTTGGACCTGACCCTG
CTCCACTCCCCGCCCGTCGCCGACGGCTGGAACTCCTTCCTGGGCGCCATCCGCACGCAAACCCTTCTTCCCGCCGACGAGCGCGAGCTAGCCATTTCCCGCGTGGCCGTCTGCAACGGC
GCCTGGTACGAGTGGCACCACCATGCGCCCCTGGCCGTTCAGGCGGGCGTCAGCGAGGGCGAGGATGGTCTGGGCGTGGTCAAGAGGCAGGAACCGCTGCTGATTGAGGAAGGGGACCAG
AAGAAGGGAGGGTTGAACGAGAGGCAGTGGGCGGCGGTGTGCTTGACGGATGAGATGACGAGGAATGTCAAGGTGCGGGATGAGACGTTTGAGAGGGTTAGAGAGTTGTTTAGCGAGAGG
GAGGTGGTGGAGTTGACTGCGATT
GTGAGTACTGTTTTTTATGGGTTGTGTCGTCATAATGAGGGGGGAAATTCGGAAAGATGCGGACGAGTGAAGAAGGAAAGGGTGAGGGAGGTGTGG
GTGAGAGTGAGATATGAGAGACCTTTAAAGGTCGAGGAGTCCGGGAAGGTGGCAAACAAAAGGCCGTGTCGTGAGCTAAGTTTTAAGGGCTAACACCGACTCACTAGATCGCTTGCTACA
ACTGCGTGAGCCGTTTCCTTGTTGCGCTGGATG
GTAAGTCTTTTCTTGTGGCTTTTTGGGACCCCAATACTAATCATATTGTGCAGTTGGAGAGAGAAACGGCACTGGTCCGGACGATGC
GGCTCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTCTCCCCTACATCCCCAACCCCCCACCCACCTCTTCGGACGCCGAACAAGCCATCGTCGACCGCATCACCGCCCGCCGCGCCCCCCGTCCCCTCCAACCCTTGGACCTGACCCTG
CTCCACTCCCCGCCCGTCGCCGACGGCTGGAACTCCTTCCTGGGCGCCATCCGCACGCAAACCCTTCTTCCCGCCGACGAGCGCGAGCTAGCCATTTCCCGCGTGGCCGTCTGCAACGGC
GCCTGGTACGAGTGGCACCACCATGCGCCCCTGGCCGTTCAGGCGGGCGTCAGCGAGGGCGAGGATGGTCTGGGCGTGGTCAAGAGGCAGGAACCGCTGCTGATTGAGGAAGGGGACCAG
AAGAAGGGAGGGTTGAACGAGAGGCAGTGGGCGGCGGTGTGCTTGACGGATGAGATGACGAGGAATGTCAAGGTGCGGGATGAGACGTTTGAGAGGGTTAGAGAGTTGTTTAGCGAGAGG
GAGGTGGTGGAGTTGACTGCGATT
ATCGCTTGCTACAACTGCGTGAGCCGTTTCCTTGTTGCGCTGGATGTTGGAGAGAGAAACGGCACTGGTCCGGACGATGCGGCTCACTGA

Retrieve as FASTA