Entry information : NcPrxII-A
Entry ID 4679
Creation 2007-02-16 (Christophe Dunand)
Last sequence changes 2012-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-22 (Christophe Dunand)
Peroxidase information: NcPrxII-A
Name NcPrxII-A
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora crassa    [TaxId: 5141 ]
Cellular localisation N/D
Tissue types Conidia
Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NcPrxII-A
start..stop
S start..stop
NcPrxII-B 269 9e-95 1..138 1..166
CgPrxII 196 6e-66 1..138 1..166
VdaPrxII01 195 2e-65 3..138 2..166
CgPrxII_CBS14851 195 2e-65 1..138 1..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4732653..4732689 37 N° 2 4732253..4732455 203 N° 3 4732008..4732184 177  
complement(join(4732008..4732184,4732253..4732455,4732653..4732689))


exon

Literature and cross-references NcPrxII-A
Literature REFERENCE 1 Zhu,H., Lai,H., Kupfer,D., Dunlap,J.C. and Roe,B.A. Two Neurospora crassa EST Databases.
REFERENCE 2 Galagan J.E. et al., The genome sequence of the filamentous fungus Neurospora crassa. Nature 422:859-868(2003).

Protein ref. UniProtKB:   Q7SDU1
DNA ref. JGI genome:   supercont10.1 (4732689..4732008)
Cluster/Prediction ref. UniGene:   Ncr.7177
Protein sequence: NcPrxII-A
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   138
PWM (Da):   %s   14790.54  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSALKAGDSFPEAFANKKVVLVAVPGAFTPTCQQQHVPSYLAKLEEFKSKGVDQIIFIASNDAWVMAAWGKANGVKDESLFMSDADCKFSKSIGWTQGDRTKRYAIVIDHGKVTYAELDEVPKSIANTGADGVLAKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo I, 3 exons), 1 mRNA (XM_959107), 11 ESTs. Strain="OR74A" and "74-OR23-1A / FGSC 987". Homology with plant PrxII but the second cysteine is in a different position.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCTCTTAAGGCCGGTGACTCTTTCCCCGAAGGTGTTACTTTCACCTACGTCGCGCCCAGCGGTGACACAGACCTTACCGTCTGCGGTCTTCCCATCCAGTATGATGCCAGCAAA
GGCAAGTAAATATATCATGGCTCACTCACAAGGAACCCTCACATCATCTTTGACTTGTATTTTTTCTCTCCACACCTATCTATATACTAACGCAATCTCTTACCCACGACGTAGCGTTCG
CGAACAAGAAGGTCGTCCTCGTCGCCGTCCCCGGTGCCTTCACCCCCACCTGCCAGCAGCAGCACGTCCCCTCGTATCTGGCCAAGCTCGAGGAGTTCAAGTCCAAGGGCGTCGACCAAA
TCATCTTCATTGCCAGCAACGATGCGTGGGTGATGGCCGCTTGGGGCAAGGCCAACGGTGTTAAAGATGAGTCTATT
GTAAGTAATAATTCATGTCCCTCCTGCCCCCCCTCACCACACC
TAACTGACACGCAACGAATGTTTAGCTCTTTATGTCCGATGCCGACTGCAAGTTCAGCAAGAGCATCGGCTGGACCCAGGGTGACCGCACCAAGCGCTATGCTATTGTCATCGACCACGG
CAAGGTTACCTACGCCGAGTTGGATGAGGTGCCTAAGAGCATCGCCAACACTGGTGCCGACGGTGTCCTGGCTAAGCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCTCTTAAGGCCGGTGACTCTTTCCCCGAAGCGTTCGCGAACAAGAAGGTCGTCCTCGTCGCCGTCCCCGGTGCCTTCACCCCCACCTGCCAGCAGCAGCACGTCCCCTCGTAT
CTGGCCAAGCTCGAGGAGTTCAAGTCCAAGGGCGTCGACCAAATCATCTTCATTGCCAGCAACGATGCGTGGGTGATGGCCGCTTGGGGCAAGGCCAACGGTGTTAAAGATGAGTCTATT
CTCTTTATGTCCGATGCCGACTGCAAGTTCAGCAAGAGCATCGGCTGGACCCAGGGTGACCGCACCAAGCGCTATGCTATTGTCATCGACCACGGCAAGGTTACCTACGCCGAGTTGGAT
GAGGTGCCTAAGAGCATCGCCAACACTGGTGCCGACGGTGTCCTGGCTAAGCTCTAA

Retrieve as FASTA