Entry information : NcPrxII-B
Entry ID 4680
Creation 2007-02-16 (Christophe Dunand)
Last sequence changes 2012-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-22 (Christophe Dunand)
Peroxidase information: NcPrxII-B
Name NcPrxII-B
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora crassa    [TaxId: 5141 ]
Cellular localisation N/D
Tissue types Conidia
Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NcPrxII-B
start..stop
S start..stop
NcPrxII-A 269 1e-94 1..166 1..138
CgPrxII 254 1e-88 1..166 1..166
CgPrxII_CBS14851 250 8e-87 1..166 1..166
VdaPrxII01 239 2e-82 3..166 2..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4732569..4732689 121 N° 2 4732253..4732455 203 N° 3 4732008..4732184 177  
complement(join(4732008..4732184,4732253..4732455,4732569..4732689))


exon

Literature and cross-references NcPrxII-B
Literature Nelson,M.A.,et al., Expressed sequences from conidial, mycelial, and sexual stages of Neurospora crassa. Fungal Genet. Biol. 21, 348-363 (1997)
Protein ref. UniProtKB:   Q6MUV6
DNA ref. JGI genome:   supercont10.1 (4732689..4732008)
mRNA ref. GenBank:   AI397652
Protein sequence: NcPrxII-B
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   17689.93  
PI (pH):   %s   5.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSALKAGDSFPEGVTFTYVAPSGDTDLTVCGLPIQYDASKAFANKKVVLVAVPGAFTPTCQQQHVPSYLAKLEEFKSKGVDQIIFIASNDAWVMAAWGKANGVKDESLFMSDADCKFSKSIGWTQGDRTKRYAIVIDHGKVTYAELDEVPKSIANTGADGVLAKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo I, 3 exons), 1 mRNA (AI397652). Splicing variant confirmed with AI397652. Homology with plant PrxII but the second cysteine is at a different position.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCTCTTAAGGCCGGTGACTCTTTCCCCGAAGGTGTTACTTTCACCTACGTCGCGCCCAGCGGTGACACAGACCTTACCGTCTGCGGTCTTCCCATCCAGTATGATGCCAGCAAA
G
GCAAGTAAATATATCATGGCTCACTCACAAGGAACCCTCACATCATCTTTGACTTGTATTTTTTCTCTCCACACCTATCTATATACTAACGCAATCTCTTACCCACGACGTAGCGTTCG
CGAACAAGAAGGTCGTCCTCGTCGCCGTCCCCGGTGCCTTCACCCCCACCTGCCAGCAGCAGCACGTCCCCTCGTATCTGGCCAAGCTCGAGGAGTTCAAGTCCAAGGGCGTCGACCAAA
TCATCTTCATTGCCAGCAACGATGCGTGGGTGATGGCCGCTTGGGGCAAGGCCAACGGTGTTAAAGATGAGTCTATT
GTAAGTAATAATTCATGTCCCTCCTGCCCCCCCTCACCACACC
TAACTGACACGCAACGAATGTTTAGCTCTTTATGTCCGATGCCGACTGCAAGTTCAGCAAGAGCATCGGCTGGACCCAGGGTGACCGCACCAAGCGCTATGCTATTGTCATCGACCACGG
CAAGGTTACCTACGCCGAGTTGGATGAGGTGCCTAAGAGCATCGCCAACACTGGTGCCGACGGTGTCCTGGCTAAGCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCTCTTAAGGCCGGTGACTCTTTCCCCGAAGGTGTTACTTTCACCTACGTCGCGCCCAGCGGTGACACAGACCTTACCGTCTGCGGTCTTCCCATCCAGTATGATGCCAGCAAA
G
CGTTCGCGAACAAGAAGGTCGTCCTCGTCGCCGTCCCCGGTGCCTTCACCCCCACCTGCCAGCAGCAGCACGTCCCCTCGTATCTGGCCAAGCTCGAGGAGTTCAAGTCCAAGGGCGTC
GACCAAATCATCTTCATTGCCAGCAACGATGCGTGGGTGATGGCCGCTTGGGGCAAGGCCAACGGTGTTAAAGATGAGTCTATT
CTCTTTATGTCCGATGCCGACTGCAAGTTCAGCAAG
AGCATCGGCTGGACCCAGGGTGACCGCACCAAGCGCTATGCTATTGTCATCGACCACGGCAAGGTTACCTACGCCGAGTTGGATGAGGTGCCTAAGAGCATCGCCAACACTGGTGCCGAC
GGTGTCCTGGCTAAGCTCTAA

Retrieve as FASTA