Entry information : GzPrxII
Entry ID 4689
Creation 2007-02-16 (Christophe Dunand)
Last sequence changes 2007-02-16 (Christophe Dunand)
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: GzPrxII
Name GzPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Nectriaceae Gibberella
Organism Gibberella zeae (anamorph Fusarium graminearum)    [TaxId: 5518 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GzPrxII
start..stop
S start..stop
VdaPrxII01 223 3e-76 4..166 3..166
CgPrxII 210 4e-71 1..166 1..166
NcPrxII-B 205 4e-69 1..166 1..166
CgPrxII_CBS14851 201 2e-67 1..166 1..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1032597..1032720 124 N° 2 1032771..1032973 203 N° 3 1033026..1033199 174  
join(1032597..1032720,1032771..1032973,1033026..1033199)


exon

Literature and cross-references GzPrxII
Literature Birren B.W. et al., Fusarium graminearum genome sequence.
Protein ref. UniProtKB_Uniparc:   Q4I281
DNA ref. JGI genome:   Supercontig_3.5 (1032597..1033199)
Protein sequence: GzPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   17695.86  
PI (pH):   %s   5.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPELKVGADFPEGVFFSYVQPTPEIAEFSTCGAPTNYNASQEFKSKKVVLISVPGAFTPTCSASHVPSYVENIEQIKAKGVDQVIVVAVNDAFVMHGWAKANGITDDKLFMSDHNAKFSTSIGWNLGERTGRFAVVIDHGKITYASSDEPGSIEKSGALGVLPHL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo II, 3 exons), mRNA and 2 partial ESTs (CD459726, CN812955). Strain="PH-1/NRRL 31084" and "DAOM 180378". Homology with PrxII but only one cystein.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGAACTCAAGGTCGGCGCCGACTTCCCCGAGGGTGTCTTCTTTAGCTACGTCCAGCCCACTCCCGAGATCGCTGAGTTCTCTACCTGTGGTGCTCCCACCAACTACAACGCCAGC
CAGG
GTAGGTGATTTCTTATAGCCCACCGGTTCCACACTGATATTGTCCTGTAGAGTTCAAGAGCAAGAAGGTCGTCCTCATCTCTGTCCCCGGTGCTTTCACTCCTACTTGCAGTGCCT
CTCACGTTCCTTCTTACGTCGAGAACATTGAGCAGATCAAGGCCAAGGGCGTTGACCAGGTCATCGTCGTTGCTGTCAACGACGCATTTGTCATGCACGGTTGGGCCAAGGCTAATGGCA
TCACCGATGACAAGATT
GTACGTATCTTGGAACATCTCTAGCACAAAGAGACAACACTAACATGGCCAGCTCTTCATGTCCGACCACAACGCCAAGTTCTCCACCAGCATCGGCTGGAAC
CTGGGCGAGCGAACTGGTCGTTTCGCCGTGGTTATCGACCACGGCAAGATCACCTATGCCTCTAGTGATGAGCCTGGAAGCATCGAGAAGTCTGGTGCCCTTGGTGTCCTTCCTCACTTG
TAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGAACTCAAGGTCGGCGCCGACTTCCCCGAGGGTGTCTTCTTTAGCTACGTCCAGCCCACTCCCGAGATCGCTGAGTTCTCTACCTGTGGTGCTCCCACCAACTACAACGCCAGC
CAGG
AGTTCAAGAGCAAGAAGGTCGTCCTCATCTCTGTCCCCGGTGCTTTCACTCCTACTTGCAGTGCCTCTCACGTTCCTTCTTACGTCGAGAACATTGAGCAGATCAAGGCCAAGGGC
GTTGACCAGGTCATCGTCGTTGCTGTCAACGACGCATTTGTCATGCACGGTTGGGCCAAGGCTAATGGCATCACCGATGACAAGATT
CTCTTCATGTCCGACCACAACGCCAAGTTCTCC
ACCAGCATCGGCTGGAACCTGGGCGAGCGAACTGGTCGTTTCGCCGTGGTTATCGACCACGGCAAGATCACCTATGCCTCTAGTGATGAGCCTGGAAGCATCGAGAAGTCTGGTGCCCTT
GGTGTCCTTCCTCACTTGTAA

Retrieve as FASTA