Entry information : HaGPx08 (HanXRQChr13g0416471)
Entry ID 4779
Creation 2007-03-02 (Christophe Dunand)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGPx08 (HanXRQChr13g0416471)
Name (synonym) HaGPx08 (HanXRQChr13g0416471)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue types Buds
Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGPx08
start..stop
S start..stop
HaGPx03 321 1e-113 1..166 69..235
HaGPx08_psc8 316 6e-113 1..166 1..166
HaGPx06 302 2e-107 1..166 1..167
SpGPx01 274 2e-96 2..164 4..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 160230657..160230698 42 N° 2 160229107..160229183 77 N° 3 160228949..160229010 62 N° 4 160228745..160228863 119
N° 5 160227971..160228138 168 N° 6 160227848..160227880 33  
complement(join(160227848..160227880,160227971..160228138,160228745..160228863,1 60228949..160229010,160229107..160229183,160230657..160230698))


exon

Literature and cross-references HaGPx08 (HanXRQChr13g0416471)
Literature Michelmore,R.W., Knapp,S., Rieseberg,L., Bradford,K., Kesseli,R., Boore,J., Kozik,A., Matvienko,M., Lavelle,D. and Lai,Z. Sunflower (Helianthus annuus) ESTs (set 2) from the Compositae. Genome Project http://compgenomics.ucdavis.edu/
DNA ref. HanXRQ genome:   HanXRQChr13 (160230698..160227848)
Cluster/Prediction ref. HanXRQ:   HanXRQChr13g0416471 UniGene:   Han.897
Protein sequence: HaGPx08 (HanXRQChr13g0416471)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   18484.57  
PI (pH):   %s   8.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSKKSVYDFTVKDAKGQEVELSKYRGKVLLIVNVASQCGFTNSNYPELTTLYQKYKDGLEILGFPSNQFNGQEPGSNEEIQEFVCTRFKAEYPVFAVDVNGKNAEPLYSFLKASKGGILGDSIKWNFTKFLVDREGKVVDRYAPTTTPLSIEKDIKKLLGVA*

Retrieve as FASTA  
Remarks Complete sequence from 5 ESTs. Strain="ANN1312" and "psc8". Compiled with two other accessions with little homology (other strains).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACATCGAAGAAATCAGTTTATGACTTCACTGTTAAGGTTTGTTGGCTATGTTGATTAAAGATTCTATTTTTATGTTGTATGTGTCAATGTCTGATTTGGGTGTTTCTTGTTTTC
TTGATTTTAGGGTTTTAGTTGTTTTGATTGGTTAAAGATTTAGATTACATTGGGTGTTTTTGTTTGTTGTTGAGTAGGTTTATGTGTGAAAGTTTTGATCTTGATAAGTGATCATGTCAT
TTGTTTTATGTTAAGGTTTGTTGATTAAAGATCCGTTTTTTTATATTGTGGGTGTTTCTTGTTTTCTTGATTTTTCAGTTTTAGTTGTTTTTTTGGTTAAAGATTTAGATTACGTTGTGG
GTTTTTGTTGTTGAGTAGGTTTGTATGTAAAAGTTTTGATCTTGATCATGTAATTTGTTTTCTGTTTGATGATTTGAATTGGCTAAAGATAGGCTGCAAACGAACCGAACGTTTAGCGAA
CGTTCATGAACCGTTCGGTGTTCATTAGTTTAATAAATAAACAAACACAAACAAGAAATTTTGTTCGTTTTGTTAAATGAACGAACATGAACAGAGGCTGCGTTTGTTCATTTATGTTTG
TGAACGTTTGGTAACGTGTTCGTGAAGGTTCACGTGTTCGTTTATGTTCATTATGTTCGTTTGTGTTTGATAATTAATTAGGGTTTTTAATATTTATATTTTATTTAATACCTTAAAGTT
CCTACTAATAAAATAGTAGTGTAGTGTTCATGAACGTTTGTTTATGTTTGTTCCCTAAAATTAACGAGCGAGCAAACACAAACGAACAAAAACACTGAACACGTCCGTTTCCTTGATGAA
CGATCACGAACAGAAAATCCCATTCGGTAAGTGTTTATCTTGTTCGGTTCAGCCCTAGTTAAAGATTTAGGTTACATTGTGGTTTTTTTTGTTGAGTAGGTTTGTCTATAAAAGTTTTGA
TCTTGATTAGTGATCATGTAATTTATCTGATTTACTGTTTGCTTTATGTTATCTTGATTTTAGTGTTTTAGTTGTTATTAGTGGTTAAAGATTTAGGTTACACTGTGGGTATTTGTTGTT
GAGCATGGTTCTATGTAAAAGTTTCGATCTTGATCAGTGATCATGTAATGTATTTTCTGTTTGCTTCGTGTTAACTTGATTTAACGGTTTTGGAGCGTATTCATTGGTTAAAGATTTTGG
TTACATTGTGGGTTTTTGTTGTTAAGTATGTTTATTTGTAAAAGTTTTGATCTTGACCATGTAATCTGTTTTGTCACAACCCGACCCGACCCCCGAAACCCGTTCTGACCCGAACCCGTT
CTGACCCATGACCCGACCCGACCCAACCCGTTTGCCAGGTCTAGTTTTGTGCTTGCTTGGTGTTATCTTGATTCTAAGGGTTTTTGAATATTTTCATTGATTCAAGATTGATCTTGATCT
TGTTAATCGTCATTGATGATGTATGCAAAATTAAGAATATAAATTATATATTTATCAATTGTTTTTTTTTTTCAGGATGCAAAGGGCCAAGAAGTGGAGCTTAGCAAGTACAGAGGAAAA
GTGTTGTTGATCGTTAATGTTGCGTCACAATG
GTAAACTATATGCTCCAATCGGTTTCCATTAATGGCGATATAAAACCAAGACAGATGTTAACGATCCATTTTCACTCTTTTTATTTTG
TGTTTCAGTGGATTTACGAATTCTAATTACCCTGAGCTTACAACCTTGTACCAGAAGTACAAGGATCAAGGTTCGATCCTTTTCTCACACTATTGAAATGTTCGGTTTCTTCCAGTATTT
TGTAGATGAGCTCACTGTGTTCTTATTATTTATAGGTCTCGAGATTCTTGGGTTTCCATCCAATCAGTTTAACGGACAAGAACCAGGAAGCAATGAAGAAATTCAGGAGTTTGTTTGCAC
TCGCTTTAAGGCCGAATATCCCGTCTTTGCTAAG
GTTGGTAATTCTACTAATTGTATTATGAAACTCAACAAAAAAATGTCTTTTGTCAAAAGGGTAAAATAGTCATTTTGCACAAATAT
AACAGATTTTTTAGCAAAAGAAGTAAAGTACACAGATAGTCCCTGTGGTTTTTCAAAATTTTTGATTTGGTTCCCTAGCTTTCCAAAAATACACGATGCTCCCAGTGGTTTGCACTTTGT
AACGCAGTTAGTCTCAAGTTCTTGCTAAAAGTACCGGAATGGTCCCTGTGGTTTGCACTTTGTAACGCATTTAGTCCCCAACCAACAAATTTGAAGATTTCAGGAGGTCCAAGTTATGGA
CTATCCAAAATTTTGGAAAGTTACATGGACTATCCGTGTGCGTTACTCTTAACAAAAGTTAATTTTAGAATTCAAACATGTTACAACTTACAAATGAAAACCACAAATCTCAAGCATTTA
ATTTTTTAAAGATAAGACCCTAAAGGTGACTTTTTCCAATCCACATGGACTATTTGTGTAATTAACCGGTCCATATGACACATTTGATTTTTTTCACCAACTGACCATTATTTAGACGCG
CTTCTACTGACCGCATATGTTGGACACTTGGTTAATGTAGGTTGACGTGAATGGTAAAAACGCCGAACCCTTGTACAGTTTCTTGAAGGCGAGCAAAGGCGGGATTCTTGGTGACAGCAT
CAAGTGGAACTTCACAAAGTTTCTAGTCGATAGAGAGGGAAAAGTCGTTGATCGTTATGCTCCAACCACCACTCCTCTAAGCATAGAG
GTAAAGCTTGTTTTGTAGCATTATCTGTCTAA
ATTCGATTTCCCGAAAAGTCACTCATGTTTTTTTTTTTTTCTTTTTGTGGTGCTGCAGAAGGATATAAAGAAGCTGCTTGGTGTTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACATCGAAGAAATCAGTTTATGACTTCACTGTTAAGGATGCAAAGGGCCAAGAAGTGGAGCTTAGCAAGTACAGAGGAAAAGTGTTGTTGATCGTTAATGTTGCGTCACAATGT
GGATTTACGAATTCTAATTACCCTGAGCTTACAACCTTGTACCAGAAGTACAAGGATCAAG
GTCTCGAGATTCTTGGGTTTCCATCCAATCAGTTTAACGGACAAGAACCAGGAAGCAAT
GAAGAAATTCAGGAGTTTGTTTGCACTCGCTTTAAGGCCGAATATCCCGTCTTTGCTAAG
GTTGACGTGAATGGTAAAAACGCCGAACCCTTGTACAGTTTCTTGAAGGCGAGCAAAGGC
GGGATTCTTGGTGACAGCATCAAGTGGAACTTCACAAAGTTTCTAGTCGATAGAGAGGGAAAAGTCGTTGATCGTTATGCTCCAACCACCACTCCTCTAAGCATAGAG
AAGGATATAAAG
AAGCTGCTTGGTGTTGCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTCACCTT TTCTTGATTT AACATTCCTA TAAATATCAA CACCCCCCAA ATGTTGTCTT CATCAGCTGG TGTCTTCAAT AACCTTATTG CTCATAAAAA TATTGTTTTC CATTAAAAAA  AATCCCCTTT TATATTATCC ATCAATCTGT TTCTTCATCA TCTAACCCAA TAGGTTCAAA AGGATCTTGG TTTTCCACAA ATTTCTCTAG TGCCAACAGA ACGTGCCCTG TGTTAGGTTA  TTTCATGGCT ACATCGAAGA AATCAGTTTA TGACTTCACT GTTAAGGATG CAAAGGGCCA AGAAGTGGAG CTTAGCAAGT ACAGAGGAAA AGTGTTGTTG ATCGTTAATG TTGCGTCACA  ATGTGGATTT ACGAATTCTA ATTACCCTGA GCTTACAACC TTGTACCAGA AGTACAAGGA TCAAGGTCTC GAGATTCTTG GGTTTCCATC CAATCAGTTT AACGGACAAG AACCAGGAAG  CAATGAAGAA ATTCAGGAGT TTGTTTGCAC TCGCTTTAAG GCCGAATATC CCGTCTTTGC TAAGGTTGAC GTGAATGGTA AAAACGCCGA ACCCTTGTAC AGTTTCTTGA AGGCGAGCAA  AGGCGGGATT CTTGGTGACA GCATCAAGTG GAACTTCACA AAGTTTCTAG TCGATAGAGA GGGAAAAGTC GTTGATCGTT ATGCTCCAAC CACCACTCCT CTAAGCATAG AGAAGGATAT  AAAGAAGCTG CTTGGTGTTG CTTAAGCAGT GTACTTATGA TGTATGCTTC CATATTTTCG CTATAAATAA GCATTGGTGT CGCTATGCAT CATAGTTTCC GAGTGTTTTA GTTTCTGAAT  GTTTTCGTGT GATTTAAGGT CGAAGTTTGA AGTTTATCTT GTGGCGGTAG TTTTATATAT AAGCCGTGTT TTTATTAATG AAATAATCTT TCTTGTATTT TCAATTTATA AAAATCTGTT 
ACGAAAATTA TGAATAAACT GCTGAGTTTT TGTTCAGTTT CATCAAGACC GGCCCTGAGA ATTCTTATAT CATGTTCGAG CTCGAAAAAA CGTGC 

Retrieve as FASTA