Entry information : GmPrx20 (Glyma10g36680.1)
Entry ID 490
Creation 2005-11-09 (Christophe Dunand)
Last sequence changes 2011-08-11 (Christophe Dunand)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx20 (Glyma10g36680.1)
Name (synonym) GmPrx20 (Glyma10g36680.1)
Class Class III peroxidase     [Orthogroup: Prx007]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Etiolated hypocotyls
Leaves
Roots
Shoot tips
Inducers Cyst nematode infection
Pathogen interaction
Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx20
start..stop
S start..stop
GmPrx314 701 0 1..356 1..356
VaPrx01 629 0 1..356 1..357
PvPrx15 623 0 5..356 3..354
LjPrx02 561 0 8..356 4..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 44789461..44789715 255 N° 2 44788822..44789016 195 N° 3 44788062..44788682 621  
complement(join(44788062..44788682,44788822..44789016,44789461..44789715))


exon

Literature and cross-references GmPrx20 (Glyma10g36680.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm10 (44789715..44788062)
Protein sequence: GmPrx20 (Glyma10g36680.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356 (326)
PWM (Da):   %s   38849.8 (35414.0)  
PI (pH):   %s   8.03 (8.20) Peptide Signal:   %s   cut: 31 range:31-356
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LASISCRSAIFSFLLICIFLSVYNIKVCEAQAKPPTAKGLSYNFYDKSCPKLKSIVRSELKKVFNKDIAQAAGLLRLHFHDCFVQGCDGSVLLDGSASGPGEKEAPPNLTLRPEAFKIIENLRGLLEKSCGRVVSCSDITALTARDAVFLSGGPDYEIPLGRRDGLTFATRQVTLDNLPPPSSNASTILSSLATKNLDPTDVVALSGGHTIGISHCGSFTNRLYPTQDPVMDKTFGNNLRRTCPAANTDNTTVLDIRSPNTFDNKYYVDLMNRQGLFTSDQDLYTNTRTKGIVTDFAVNQSLFFDKFVFAMLKMGQLNVLTGNQGEIRANCSVRNANNKSLLTSVVQDVVETLIEM*

Retrieve as FASTA  
Remarks Partial sequence from genomic and 17 ESTs. Very short 5' end (ATG) is missing. Based on the duplicated gene, "M" should be instead of "L" (CTG codon). Same sequence has been found in the genome and in one EST. Possibility of an extra 5'intron.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTGGCTTCTATTTCTTGTAGGAGTGCTATTTTCAGCTTTCTTCTCATCTGCATCTTTCTTTCTGTTTACAATATCAAAGTGTGTGAGGCACAAGCCAAGCCTCCCACAGCGAAGGGGCTA
TCATATAACTTCTACGACAAAAGCTGTCCTAAGCTTAAATCTATCGTTAGATCAGAGCTCAAAAAGGTCTTCAACAAGGACATTGCTCAAGCTGCTGGCTTGCTTCGCCTTCACTTCCAT
GACTGCTTTGTTCAG
GTAATAATAATTAACTAAATAGCCAAGCTAGGAGCTCGATCACTCTTATCAGTAAAAACATCTATATAATATACAATTAATTATTACAATTTTTTTCTACTACCC
AAACTTGATACTTATGCTTATAATTAACTTGGGTAGTTTACAGAATGAGCAGCAGTAGCGAATAACAAACACTCGTAAGACTTCTAGTACTCATGCACAATAGCATCACTAAACATTTTT
TTAAAGTACGAAAAGTTAACAAAGCAATCATTATATAAATGATGATCAAGCAAATCAAATTGAATCTGTCTCTTAATTATCATTAGGCCAAATTAGAACACAATTATTGAAAACATAATA
CAAATATTAATTTGGAGTAACAAATATTCTGACATATGCATTGATGACTATGGCTGGTAATTAATTAACGTGGATGGATAAAAAAATTGAAACATGTAGGGTTGTGATGGGTCAGTGTTA
TTGGATGGATCAGCAAGTGGGCCGGGTGAGAAAGAAGCACCACCAAACTTGACTTTGAGACCTGAGGCCTTTAAGATAATCGAAAACCTTCGTGGTCTTTTAGAGAAGAGCTGTGGAAGA
GTGGTCTCCTGCTCCGACATCACTGCCCTCACTGCACGAGATGCTGTTTTCCTT
GTAAGTACAAATAATTATTTGGTTATAGGTTAAAATTTTGTAGAAACTTTTTGACAGTGAATTGAT
TCAGTTATGGTTATAAGGAACTTGTGAAGTATCTTACATAATTAAAAACAATTAAAGAATTTGATAAAAACAGTCAGGAGGACCAGACTATGAGATTCCTTTGGGAAGGAGAGACGGGCT
AACCTTTGCCACAAGACAAGTGACATTGGACAACCTTCCACCACCTTCAAGCAACGCCTCAACCATCCTAAGCTCCCTCGCCACCAAAAACCTCGACCCAACCGATGTCGTAGCCCTCTC
AGGTGGCCACACCATAGGCATCAGCCACTGCGGTTCCTTCACCAACAGGCTCTACCCCACCCAAGACCCCGTCATGGACAAGACCTTCGGCAACAACCTCAGACGCACGTGCCCCGCCGC
CAACACCGACAACACCACCGTTCTTGACATCCGATCCCCCAACACCTTCGACAACAAGTACTACGTTGACCTCATGAACCGCCAGGGCCTCTTCACCTCCGACCAAGACCTTTACACTAA
TACGAGGACTAAGGGCATTGTCACCGACTTTGCCGTTAACCAGAGCCTCTTCTTTGACAAGTTTGTGTTCGCTATGCTCAAGATGGGTCAGCTTAATGTGCTCACGGGGAATCAAGGGGA
GATTCGTGCCAATTGCTCCGTTAGAAATGCCAATAACAAGTCCCTCTTGACTTCTGTGGTGCAAGACGTGGTCGAAACTTTGATAGAAATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTGGCTTCTATTTCTTGTAGGAGTGCTATTTTCAGCTTTCTTCTCATCTGCATCTTTCTTTCTGTTTACAATATCAAAGTGTGTGAGGCACAAGCCAAGCCTCCCACAGCGAAGGGGCTA
TCATATAACTTCTACGACAAAAGCTGTCCTAAGCTTAAATCTATCGTTAGATCAGAGCTCAAAAAGGTCTTCAACAAGGACATTGCTCAAGCTGCTGGCTTGCTTCGCCTTCACTTCCAT
GACTGCTTTGTTCAG
GGTTGTGATGGGTCAGTGTTATTGGATGGATCAGCAAGTGGGCCGGGTGAGAAAGAAGCACCACCAAACTTGACTTTGAGACCTGAGGCCTTTAAGATAATCGAA
AACCTTCGTGGTCTTTTAGAGAAGAGCTGTGGAAGAGTGGTCTCCTGCTCCGACATCACTGCCCTCACTGCACGAGATGCTGTTTTCCTT
TCAGGAGGACCAGACTATGAGATTCCTTTG
GGAAGGAGAGACGGGCTAACCTTTGCCACAAGACAAGTGACATTGGACAACCTTCCACCACCTTCAAGCAACGCCTCAACCATCCTAAGCTCCCTCGCCACCAAAAACCTCGACCCAACC
GATGTCGTAGCCCTCTCAGGTGGCCACACCATAGGCATCAGCCACTGCGGTTCCTTCACCAACAGGCTCTACCCCACCCAAGACCCCGTCATGGACAAGACCTTCGGCAACAACCTCAGA
CGCACGTGCCCCGCCGCCAACACCGACAACACCACCGTTCTTGACATCCGATCCCCCAACACCTTCGACAACAAGTACTACGTTGACCTCATGAACCGCCAGGGCCTCTTCACCTCCGAC
CAAGACCTTTACACTAATACGAGGACTAAGGGCATTGTCACCGACTTTGCCGTTAACCAGAGCCTCTTCTTTGACAAGTTTGTGTTCGCTATGCTCAAGATGGGTCAGCTTAATGTGCTC
ACGGGGAATCAAGGGGAGATTCGTGCCAATTGCTCCGTTAGAAATGCCAATAACAAGTCCCTCTTGACTTCTGTGGTGCAAGACGTGGTCGAAACTTTGATAGAAATGTAA

Retrieve as FASTA