Entry information : GmPrx23 (Glyma05g22180.1)
Entry ID 493
Creation 2007-02-02 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx23 (Glyma05g22180.1)
Name (synonym) GmPrx23 (Glyma05g22180.1)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Immature pods
Leaves
Roots
Shoot tips
Whole seedlings
Inducers Cyst nematode infection
Pathogen interaction
Phytophthora infection
Salt stress
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx23
start..stop
S start..stop
GmPrx290 609 0 1..325 1..325
MtPrx38 573 0 1..325 1..323
MsPrx12 572 0 1..325 1..323
TrPrx02 564 0 1..325 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27214897..27215115 219 N° 2 27214313..27214513 201 N° 3 27213796..27213961 166 N° 4 27212091..27212482 392
complement(join(27212091..27212482,27213796..27213961,27214313..27214513,2721489 7..27215115))


exon

Literature and cross-references GmPrx23 (Glyma05g22180.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 11:   Gm05 (27215115..27212091)
Protein sequence: GmPrx23 (Glyma05g22180.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326
PWM (Da):   %s   35475  
PI (pH):   %s   8.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRLNLLLVWSLSLTLFLNYLHPTSAQLSPNHYANICPNLESIVRQAVTNKFQQTFVTVPATLRLFFHDCFVQGCDASVLIASTGNNQAEKDHQDNLSLAGDGFDTVIKAKAAVDAVPQCRNKVSCADILALATRDVIALSGGPSYTVELGRFDGLVSRASDVNGRLPQPTNNLNQLNSLFAANGLTQTDMIALSGAHTLGFSHCSKFASRIYSTPVDPTLNKQYVAQLQQMCPRNVDPRIAINMDPTTPRKFDNVYYQNLQQGKGLFTSDQILFTDPRSRNTVNSFASSTNVFNSNFVAAMTKLGRVGVKTARNGKIRTDCSVL

Retrieve as FASTA  
Remarks Complete sequence from genomic and 41 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGGCTTAATCTCCTACTTGTGTGGTCACTCTCTTTAACACTTTTCCTTAATTATCTACACCCAACCTCTGCCCAGCTCAGTCCAAACCACTATGCTAACATATGCCCCAACCTT
GAAAGCATCGTTAGACAAGCCGTTACTAATAAGTTCCAACAAACCTTTGTCACCGTCCCAGCCACCCTTCGCCTATTCTTTCACGATTGCTTTGTCCAG
GTAACTCTCAATTCCATACCC
ACATAATGCCAAGTATTGCAATCACACTCGCAGTTTCATTGGGATCCTTGACATTGCAGCAAATACTACTTTTACAATAACGGAGTACACTTTTATATAAGATTATTNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGCAGTCATGATGTGGTCGCAAAAAGTATAAAAAAT
TAAAAATCGTTACTTGCGACCGAAATTACAGTTGCAAACAGTTTTTTTAAAGGCAATTCACGTACACTTGAGATGATTTCTTGTATCAATGTGCTAATTTTGTTGTGTGTTCTGTGTTAA
AGGGTTGTGATGCTTCCGTTTTGATTGCATCCACCGGAAATAACCAGGCAGAGAAGGATCACCAAGACAACCTGTCTTTGGCGGGTGATGGGTTTGACACAGTGATCAAAGCAAAGGCTG
CAGTAGATGCCGTCCCTCAGTGCAGAAACAAAGTCTCGTGTGCAGATATTCTGGCCTTGGCCACCCGTGATGTTATTGCACTG
GTTAGTTCTTCAATGACTCCAATTGGCGTGAAAAAAA
CAGTTTAATTTTTGTGACCACTAATTTATTTTGGATAAATAACCACTTTTAGTAAAGAAATATTTAGTGTTTAAATGTATAAAAAGTGTCACAATCTAAATTTTAAAAGAAAATATAGTC
TTGGAATGCATAATAAAAAGTGTGACAATCTAAATTGTATAATAAAATATATTTATCAAATTTTTTACACATTTAAAAATTAAATTACTAGTATTTTACAGTTTCAAGTACTAAAAGTTG
ACATTTATCCAATTTATTTTCTTAAGAGATGGGTTAAAATAAATTAACAAATGCATGTGGGTGTATGTGTGTAGTCTGGTGGACCTTCTTACACGGTTGAATTGGGAAGATTTGATGGGC
TAGTTTCGAGAGCTTCGGATGTGAATGGGAGGCTTCCACAGCCAACGAACAATTTGAACCAGCTGAACTCACTGTTTGCGGCAAACGGGCTTACCCAAACTGACATGATTGCTCTCTCAG
GTAATCCTCGTGCAACTGTTTACAAATGGGTCCCATTAGCGTTTGTGCACGCCATTAGGCTTGTTAGAGTAGTTGATATTTGATAATGTATCTTCTCATTTATGTTATTGCAAAGTATAG
TCAAATGAGGAGATAATGATTCACGAGCGAATTGAAGTAGTACACGCTTAGGCCGTTTGGTTAATTAGGCTTAATAAAAGAAGGGTGGTTGGGGAGAGAATTTATTGTATGGTTGGGACC
CATGCTAATACTTAATTTTATCAAATTTGTTGTAAATTGAAAACTTTAACTGTCTTTAAAATTAAAAACAGTAGAGACTATAAATATGTAGTGATGTCATTTCATATAATAGTTTCTCAA
GAAGAGAGGGGGTACAATACACATTTAAGTAGTTTGATTTTGGGAAGAAATGAATAGGTGATTCAGAATAATTTTGTGTCTATAGTCTTAATTAATATGTATATTATATATACTTAAATT
TTTAATTTATGAATAAAAATTAATTATATTTAATTATGTAAAATGTAGAGATATTTACAGATTTGTAAAGATCATGAAAGTGGAATCTTACCTAATAATTTCTTAGGATTTAAATCAATT
TTCTTAACATAGGTTTTTAATTGTGATGTAATTTTCATTATATCCTTGATGTAGGTTTTTAATTAAATAATTTCCTTAACGTCAATTCTTAAATGGATTTAAATATGTAAAAGTGAAAAT
CCTTAAATAATTACAAAGTTTAAAAAAAATTGTTTTATATTTTAGTTTTGAAAAATGTATAATTATTAAAATATTTTAAACATGATTTTTATCATTTCTTTGTATAAATGCTCAAACCAG
GCTTTAAAAATGATAAATAGTGTACTCCTTTCCCTCTCTAGATTCATCTCTTCCGCAACACAGCGTTCAATAGAACGGGAAAAAATCAAATTGAAAAGAAAAATTAAAATTAAAATAGTG
TATGAAAATATGAGATACATGCCAAAATTTGGAAACTTTCCTCATATTTTCCTTTCTTTATTCAACAACCAATCATGGCCTTCAATCATTTTGGGATGAAGAGGGTAATAAAAGATTCGT
GTATTAAATATAATAAAACACAACCATTTATGCATCAGAAGCCACTCAATCAAACAACATAGAAAACCGAGCTTGACGCATGTGAGCTTGGATGCAAGTTGCACGGCCAAAGCAGCAGCC
AGAAAACGAACCCTCGTGTTCAGATCTGAAATCCAAATCAAAAGTGCTTATTACACTTATTATCTCTCTCTAACAAGTAACAACGTGCTTAATTATCACTTTTTTTTTGGCAGGTGCACA
CACCCTTGGATTCTCCCACTGCAGCAAGTTCGCCAGTAGAATATACAGCACCCCAGTGGACCCAACACTGAACAAGCAATACGTAGCCCAATTGCAACAAATGTGCCCAAGAAACGTGGA
TCCTAGGATTGCCATCAACATGGACCCAACAACTCCTCGTAAATTCGACAATGTTTATTACCAAAACCTTCAACAAGGAAAGGGCCTCTTCACCTCGGACCAAATCCTCTTCACGGACCC
AAGGTCTAGGAACACCGTTAATTCCTTTGCTTCCAGTACCAACGTTTTCAACTCCAACTTTGTGGCTGCTATGACCAAATTGGGTCGCGTTGGAGTTAAGACTGCAAGAAATGGGAAAAT
TCGTACCGATTGTTCTGTGCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGGCTTAATCTCCTACTTGTGTGGTCACTCTCTTTAACACTTTTCCTTAATTATCTACACCCAACCTCTGCCCAGCTCAGTCCAAACCACTATGCTAACATATGCCCCAACCTT
GAAAGCATCGTTAGACAAGCCGTTACTAATAAGTTCCAACAAACCTTTGTCACCGTCCCAGCCACCCTTCGCCTATTCTTTCACGATTGCTTTGTCCAG
GGTTGTGATGCTTCCGTTTTG
ATTGCATCCACCGGAAATAACCAGGCAGAGAAGGATCACCAAGACAACCTGTCTTTGGCGGGTGATGGGTTTGACACAGTGATCAAAGCAAAGGCTGCAGTAGATGCCGTCCCTCAGTGC
AGAAACAAAGTCTCGTGTGCAGATATTCTGGCCTTGGCCACCCGTGATGTTATTGCACTG
TCTGGTGGACCTTCTTACACGGTTGAATTGGGAAGATTTGATGGGCTAGTTTCGAGAGCT
TCGGATGTGAATGGGAGGCTTCCACAGCCAACGAACAATTTGAACCAGCTGAACTCACTGTTTGCGGCAAACGGGCTTACCCAAACTGACATGATTGCTCTCTCAG
GTGCACACACCCTT
GGATTCTCCCACTGCAGCAAGTTCGCCAGTAGAATATACAGCACCCCAGTGGACCCAACACTGAACAAGCAATACGTAGCCCAATTGCAACAAATGTGCCCAAGAAACGTGGATCCTAGG
ATTGCCATCAACATGGACCCAACAACTCCTCGTAAATTCGACAATGTTTATTACCAAAACCTTCAACAAGGAAAGGGCCTCTTCACCTCGGACCAAATCCTCTTCACGGACCCAAGGTCT
AGGAACACCGTTAATTCCTTTGCTTCCAGTACCAACGTTTTCAACTCCAACTTTGTGGCTGCTATGACCAAATTGGGTCGCGTTGGAGTTAAGACTGCAAGAAATGGGAAAATTCGTACC
GATTGTTCTGTGCTTTAA

Retrieve as FASTA