Entry information : Ha1CysPrx (HanXRQChr07g0194341)
Entry ID 4955
Creation 2010-05-26 (Christophe Dunand)
Last sequence changes 2016-05-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: Ha1CysPrx (HanXRQChr07g0194341)
Name (synonym) Ha1CysPrx (HanXRQChr07g0194341)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ha1CysPrx
start..stop
S start..stop
Vv1CysPrx 385 2e-138 1..219 1..219
Nt1CysPrx01 375 1e-134 1..219 1..216
Egu1CysPrx03 366 5e-131 1..219 1..219
Egr1CysPrx03 366 5e-131 1..219 1..219
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58053058..58053175 118 N° 2 58052840..58052988 149 N° 3 58052600..58052746 147 N° 4 58052280..58052525 246
complement(join(58052280..58052525,58052600..58052746,58052840..58052988,5805305 8..58053175))


exon

Literature and cross-references Ha1CysPrx (HanXRQChr07g0194341)
Literature Liu,A. and Burke,J.M. Patterns of Nucleotide Diversity in Wild and Cultivated Sunflower. Unpublished. Submitted (20-APR-2006)
Protein ref. UniProtKB:   Q15CL7
DNA ref. HanXRQ genome:   HanXRQChr07 (58053175..58052280)
Cluster/Prediction ref. UniGene:   Han.2357
Protein sequence: Ha1CysPrx (HanXRQChr07g0194341)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   219
PWM (Da):   %s   24039.29  
PI (pH):   %s   6.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTIGDSLPNLQVDTTHGKINLHDYVGDSFTIIFSHPGDFTPVCTTELGAMAAYADKFAQRGVKLLGLSCDDVQSHKEWIKDIEAYKGKKVTYPIAADPNREIIKQLNMVDPDEKDASGQNLPSRALHIVGPDKKIKLSFLYPASTGRNMDEVVRALDSLIKASQHKIATPVNWKEGEPVVIAPSVSNDEARKMFPKGFQTVDLPSNKDYLRFTSV*

Retrieve as FASTA  
Remarks Complete sequence from Genomic (3 introns) and 25 ESTs. Isolate="HIDATSA1" and "HIDATSA2", cultivar="RHA801". "A" added at position 16 of cDNA (based on other homologs).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGCCTAACCATCGGAGACTCCCTCCCCAACCTCCAAGTTGACACCACTCATGGCAAGATCAATCTGCATGACTATGTTGGCGACTCATTCACCATCATCTTCTCTCACCCTGGT
TCGTCTTTTCCTTTCCCTTTGAAATAACAATTCATATCATATATTTTTCAAGTTGAAAATAGTGCAGGTGACTTCACGCCTGTTTGCACGACCGAGCTGGGGGCGATGGCGGCATACGCT
GACAAGTTTGCCCAGAGGGGTGTGAAGCTGTTGGGGTTATCCTGTGATGATGTCCAGTCTCACAAGGAGTGGATCAAAGATATTGAAGCCTATAAC
GTATGTATATGTATATGTATATGT
ATATGTATATGTATATGTATACTCATCAATCAAAACCTACCTGTTAATACTATTGTGATGTTGGTGCAGAAGGGAAAGAAGGTGACGTACCCGATCGCTGCTGATCCCAACCGGGAGATC
ATCAAGCAGCTCAACATGGTGGATCCTGATGAGAAAGATGCTTCTGGACAGAACCTCCCCTCTCGTGCTCTGCACATTGTTGGCCCCGACAAAAAG
GTACTATATGATATTGTTTGAAAA
GTGTGTATATATATAAATATATATGTTGATGAATGGATCGTGTTGTGTAGATAAAGTTGAGCTTCCTGTATCCTGCGAGCACGGGAAGGAACATGGACGAGGTGGTGAGGGCGCTGGACT
CCTTGATCAAGGCTTCCCAGCACAAAATAGCCACTCCGGTCAACTGGAAGGAGGGTGAACCAGTTGTCATCGCTCCCAGCGTCTCCAACGATGAGGCCAGGAAAATGTTTCCCAAGGGCT
TTCAGACAGTTGATCTCCCATCCAACAAGGACTATCTTCGTTTTACTAGTGTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGCCTAACCATCGGAGACTCCCTCCCCAACCTCCAAGTTGACACCACTCATGGCAAGATCAATCTGCATGACTATGTTGGCGACTCATTCACCATCATCTTCTCTCACCCTGGT
GACTTCACGCCTGTTTGCACGACCGAGCTGGGGGCGATGGCGGCATACGCTGACAAGTTTGCCCAGAGGGGTGTGAAGCTGTTGGGGTTATCCTGTGATGATGTCCAGTCTCACAAGGAG
TGGATCAAAGATATTGAAGCCTATAAC
AAGGGAAAGAAGGTGACGTACCCGATCGCTGCTGATCCCAACCGGGAGATCATCAAGCAGCTCAACATGGTGGATCCTGATGAGAAAGATGCT
TCTGGACAGAACCTCCCCTCTCGTGCTCTGCACATTGTTGGCCCCGACAAAAAG
ATAAAGTTGAGCTTCCTGTATCCTGCGAGCACGGGAAGGAACATGGACGAGGTGGTGAGGGCGCTG
GACTCCTTGATCAAGGCTTCCCAGCACAAAATAGCCACTCCGGTCAACTGGAAGGAGGGTGAACCAGTTGTCATCGCTCCCAGCGTCTCCAACGATGAGGCCAGGAAAATGTTTCCCAAG
GGCTTTCAGACAGTTGATCTCCCATCCAACAAGGACTATCTTCGTTTTACTAGTGTTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAAATGCCT GGCCTAACCA TCGGAGACTC CCTCCCCAAC CTCCAAGTTG ACACCACTCA TGGCAAGATC AATCTGCATG ACTATGTTGG CGACTCATTC ACCATCATCT TCTCTCACCC  TGGTGACTTC ACGCCTGTTT GCACGACCGA GCTGGGGGCG ATGGCGGCAT ACGCTGACAA GTTTGCCCAG AGGGGTGTGA AGCTGTTGGG GTTATCCTGT GATGATGTCC AGTCTCACAA  GGAGTGGATC AAAGATATTG AAGCCTATAA CAAGGGAAAG AAGGTGACGT ACCCGATCGC TGCTGATCCC AACCGGGAGA TCATCAAGCA GCTCAACATG GTGGATCCTG ATGAGAAAGA  TGCTTCTGGA CAGAACCTCC CCTCTCGTGC TCTGCACATT GTTGGCCCCG ACAAAAAGAT AAAGTTGAGC TTCCTGTATC CTGCGAGCAC GGGAAGGAAC ATGGACGAGG TGGTGAGGGC  GCTGGACTCC TTGATCAAGG CTTCCCAGCA CAAAATAGCC ACTCCGGTCA ACTGGAAGGA GGGTGAACCA GTTGTCATCG CTCCCAGCGT CTCCAACGAT GAGGCCAGGA AAATGTTTCC  CAAGGGCTTT CAGACAGTTG ATCTCCCATC CAACAAGGAC TATCTTCGTT TTACTAGTGT TTAGAACCTA GCTACCTTnC ATATAATAAT AATAATATGA AATAACAAAC TTTCTATGCA 
TGCATACGTT TGACTTTATT ACTTAT 

Retrieve as FASTA