Entry information : Ani1CysPrx01
Entry ID 4961
Creation 2007-03-13 (Filippo Passardi)
Last sequence changes 2012-04-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-25 (Christophe Dunand)
Peroxidase information: Ani1CysPrx01
Name Ani1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ani1CysPrx01
start..stop
S start..stop
Aor1CysPrx 381 1e-136 1..223 1..225
Acl1CysPrx 369 3e-132 1..223 1..223
Dh1CysPrx 329 5e-116 29..220 29..220
Pno1CysPrx02 305 2e-106 29..223 28..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1631541..1631564 24 N° 2 1631622..1631729 108 N° 3 1631787..1631879 93 N° 4 1631934..1632093 160
N° 5 1632152..1632404 253 N° 6 1632480..1632513 34  
join(1631541..1631564,1631622..1631729,1631787..1631879,1631934..1632093,1632152 ..1632404,1632480..1632513)


exon

Literature and cross-references Ani1CysPrx01
Literature Galagan J.E. et al. Sequencing of Aspergillus nidulans and comparative analysis with A.fumigatus and A. oryzae. Nature 438 (7071), 1105-1115 (2005)
Protein ref. GenPept:   EAA64812 [Incorrect prediction] UniProtKB:   Q5BCN8 [Incorrect prediction]
DNA ref. JGI genome:   ChrVII_A_nidulans_FGSC_A4 (1631541..1632513)
mRNA ref. GenBank:   EAA64812 [Incorrect prediction]
Protein sequence: Ani1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   223
PWM (Da):   %s   24404.7  
PI (pH):   %s   6.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEGRAAPLRLGSTAPNFTADTSNGPITFHDYIGDSWAILFSHPDDFTPICTTELGAFAKLEPEFTARGVKLIGLSANGTESHKAWIKDIDEVTGSKLTFPIISDPERKIAHQYDMVDYQDTTNVDSKGMALTIRSVFIIDPAKKIRLIMTYPASTGRNTAEVLRVVDALQTTEKHGVTTPINWLPGDDVVIPPPVSTEDAQKKFGDVRVVKPYLRFTNLKKE

Retrieve as FASTA  
Remarks Complete sequence from Genomic (Chromo VII, 6 exons). No EST (EST found with other aspergillus). Incorrect prediction in NCBI/SwissProt (too long, splicing is incorrect --> checked with FGeneSH-SoftBerry) and JGI (last short exon is missing). Strain="FGSC A4".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAAGGACGCGCTGCACCGTGAGTCTTCCCTACATAGCTTCTTCCCGTGCTTGTTAACTGACAGGAAATTTATAGCCTTCGTCTCGGCTCTACTGCCCCCAACTTCACTGCCGAC
ACCTCCAACGGCCCTATCACTTTCCACGACTACATTGGTGACAGCTGGGCTATCCTCTTCTCCCACCCC
GTAAGTGGTTTTGAGACAAGGAGTACAAACTGCATATTAACCGTCGTCTCG
GGTTAGGATGACTTCACCCCTATCTGCACTACTGAGCTTGGTGCTTTCGCCAAGCTTGAGCCCGAGTTCACTGCTCGTGGCGTCAAGCTGATCGGTCTCGTGCGTGGACACCGTTGTGCC
CCTCATACTAGGTCCCTTACTAACTCCTCATAGAGCGCCAACGGCACTGAATCCCACAAGGCCTGGATCAAGGACATTGACGAGGTCACCGGCTCAAAGCTGACCTTCCCCATCATCTCC
GATCCCGAGCGCAAGATCGCCCACCAGTACGACATGGTTGACTACCAGGACACCACCAACGTTGACTCCAAGG
GTATGTGGGATCTAGGAATATGCTGAACTTGAGCTTCTCTCTAACCA
CTTTCCCGCAGGTATGGCTCTTACCATCCGTTCCGTCTTCATCATCGACCCTGCCAAGAAGATCCGCCTCATCATGACCTACCCCGCCTCCACCGGCCGCAACACGGCTGAGGTCCTCCG
TGTCGTTGATGCCCTCCAGACCACCGAGAAGCACGGTGTTACCACCCCCATCAACTGGCTTCCTGGTGACGACGTTGTCATCCCTCCTCCCGTCTCCACCGAGGATGCTCAGAAGAAGTT
CGGCGACGTCCGTGTTGTCAAGCC
GTAAGTTCACCCGAGCCTGGAGCATTCATCAGTTGTTTGGAGCAGTTGAGCAGTTGCTAACCATCTCTCGTGCAGTTACCTGCGTTTCACCAACCT
CAAGAAGGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAAGGACGCGCTGCACCGCTTCGTCTCGGCTCTACTGCCCCCAACTTCACTGCCGACACCTCCAACGGCCCTATCACTTTCCACGACTACATTGGTGACAGCTGGGCTATCCTC
TTCTCCCACCCC
GATGACTTCACCCCTATCTGCACTACTGAGCTTGGTGCTTTCGCCAAGCTTGAGCCCGAGTTCACTGCTCGTGGCGTCAAGCTGATCGGTCTCAGCGCCAACGGCACT
GAATCCCACAAGGCCTGGATCAAGGACATTGACGAGGTCACCGGCTCAAAGCTGACCTTCCCCATCATCTCCGATCCCGAGCGCAAGATCGCCCACCAGTACGACATGGTTGACTACCAG
GACACCACCAACGTTGACTCCAAGG
GTATGGCTCTTACCATCCGTTCCGTCTTCATCATCGACCCTGCCAAGAAGATCCGCCTCATCATGACCTACCCCGCCTCCACCGGCCGCAACACG
GCTGAGGTCCTCCGTGTCGTTGATGCCCTCCAGACCACCGAGAAGCACGGTGTTACCACCCCCATCAACTGGCTTCCTGGTGACGACGTTGTCATCCCTCCTCCCGTCTCCACCGAGGAT
GCTCAGAAGAAGTTCGGCGACGTCCGTGTTGTCAAGCC
TTACCTGCGTTTCACCAACCTCAAGAAGGAATAA

Retrieve as FASTA